KEGG   Streptomyces coelicolor: SCO2033Help
Entry
SCO2033           CDS       T00085                                 

Gene name
SC4G6.02
Definition
(RefSeq) citrate lyase subunit beta
  KO
K01644  
citrate lyase subunit beta / citryl-CoA lyase [EC:4.1.3.34]
Organism
sco  Streptomyces coelicolor
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:sco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCO2033 (SC4G6.02)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.34  citryl-CoA lyase
     SCO2033 (SC4G6.02)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
2184330..2185154
Genome map
AA seq 274 aa AA seqDB search
MTAPPLTWLYVPGDRPRVVAKALAAGADVVVVDLEDAVAADRKEYARDATAELLTEPQPV
PVHVRVNALDGPLAAGDLAALAALPGLSGLRLPKVTAPEQVTGVAALTGGPPLYALLETA
LGVERAYRIAAAHPALRGIALGEADLRADLGVRGDAGLDWSRSRVVVAARAAGLAPPSQT
VHPDTRDLEGLAASCAHGRALGFLGRAAIHPRQLPIIERAYLPTERELEEAETIVKAATV
QPGAQALPDGRFIDAAVVATARRTLSLARRPTLS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccccgctgacctggctgtacgtgccgggggaccggccgcgggtggtggcc
aaggcgctggccgccggtgccgacgtggtggtcgtcgacctggaggacgcggtcgccgcc
gaccgcaaggagtacgcccgcgacgccacggccgagctgctcaccgagccgcagccggtg
ccggtgcacgtccgcgtcaacgccctggacggtccgctcgccgccggggacctggcggcg
ctggccgcgctgccggggctgtccgggctgcggctgcccaaggtgacggcgccggagcag
gtgaccggcgtcgccgcgctgaccggcggaccgccgctgtacgccctgctggagacggcc
ctgggggtggagcgggcgtaccggatcgccgcggcccatccggcactgcgcgggatcgct
ctcggtgaggcggacctccgtgccgacctgggcgtgcgcggggacgcgggcctggactgg
tcgcgctcgcgcgtggtcgtggccgcgcgggcggcgggcctggcgccgccgtcccagacg
gtgcatccggacacccgggacctggagggcctggcggcgtcctgcgcccacggccgcgcc
ctgggcttcctggggcgggccgcgatccacccgcgccagctgccgatcatcgagcgggcc
tatctgcccaccgaacgggagctggaggaggcggagacgatcgtcaaggcggccacggtc
cagccgggtgcgcaggcgctgccggacggccggttcatcgacgcggcggtggtggcgacg
gcccggcggacgctgtcgctggcccggcggcccaccctgtcctga

DBGET integrated database retrieval system