KEGG   Streptomyces coelicolor: SCO2043Help
Entry
SCO2043           CDS       T00085                                 

Gene name
SC4G6.12c, trpE3
Definition
(RefSeq) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco00405  Phenazine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
sco02024  Quorum sensing
Module
sco_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2043 (SC4G6.12c)
  Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    SCO2043 (SC4G6.12c)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SCO2043 (SC4G6.12c)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SCO2043 (SC4G6.12c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-GeneID: 1097477
NCBI-ProteinID: NP_626303
Kitasato: SCO2043
UniProt: Q9S2U2
Position
complement(2192224..2193732)
Genome map
AA seq 502 aa AA seqDB search
MDVTHDMDLDTFRKLAADRRVIPVSRKLLADGDTPVALYRKLAASRPGTFLLESAENGRS
WSRYSFVGVRSAATLTEKDGQAHWQGTPPVGVPTDGDPLAALRATVEALHTPRDLAHDLG
LPPFTGGMVGYLGYDIVRRLEKVGPGERDDLKLPELTMLLTSDLAVMDHWEGSVLLIANA
INHNDLETGVDEAYADAIARLDVMEADLTRAVAQPPAALPPSELPEYTALWGGPDFQDAV
EDIKERIRAGEAFQVVPSQRFETPCTASALDVYRVLRATNPSPYMYLLRLDGFDVVGSSP
EALVKVEDGRAMVHPIAGTRPRGATPREDQSLADELLADPKERAEHLMLVDLGRNDLGRV
CEPGSVEVVDFMSVERYSHVMHIVSTVTGRVAPGRTAFDVLTACFPAGTLSGAPKPRALQ
IIDELEPSRRGLYGGCVGYLDFAGDSDTAIAIRTALLRDGTAYVQAGAGVVADSDPVAED
TECRNKAAAVLRAVHTANRLAQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcacgcatgacatggacctcgacaccttccgcaagctcgccgccgaccgccgg
gtgatcccggtgagccgcaagctcctcgccgacggcgacaccccggtcgcgctgtaccgc
aagctcgccgcctcgcgccccggcaccttcctgctggagtccgcggagaacggacgctcc
tggtccaggtactccttcgtcggcgtccgcagcgccgccaccctcaccgagaaggacggc
caggcgcactggcagggcaccccgcccgtcggcgtccccaccgacggcgacccgctcgcc
gccctgcgcgccaccgtcgaggccctgcacaccccgcgcgacctcgcccacgacctgggc
ctgccgcccttcaccggcggcatggtgggctacctcgggtacgacatcgtgcgccgcctg
gagaaggtcggcccgggggagcgcgacgacctgaagctgcccgagctgaccatgctgctc
accagcgacctcgccgtcatggaccactgggagggctcggtcctgctgatcgccaacgcg
atcaaccacaacgacctggagaccggcgtcgacgaggcctacgccgacgcgatcgcccgc
ctcgacgtcatggaggccgacctcacgcgtgccgtcgcccagcccccggccgcgctgccc
ccctccgagctgcccgagtacaccgcgctgtggggcggccccgacttccaggacgccgtc
gaggacatcaaggagcgcatccgcgcgggcgaggccttccaggtcgtcccctcccagcgc
ttcgagacgccctgcacggcgagcgccctcgacgtctaccgggtcctgcgggccaccaac
ccctccccgtacatgtacctgctccgtctcgacggcttcgacgtcgtcggctcgtccccc
gaggcgctggtcaaggtcgaggacgggcgcgccatggtgcaccccatcgccggtacccgc
ccgcgcggcgccaccccgcgggaggaccagtccctcgccgacgaactgctcgccgacccc
aaggagcgcgccgagcacctgatgctggtcgacctcggccgcaacgacctcgggcgcgtc
tgcgagcccgggtccgtcgaggtcgtcgacttcatgtccgtcgagcggtactcgcacgtc
atgcacatcgtctcgacggtcaccggccgggtcgccccgggccgcaccgccttcgacgtc
ctcaccgcctgcttcccggccggcaccctctccggcgcgcccaagccgcgcgccctgcag
atcatcgacgaactcgagccctcccggcgcggcctgtacggcggctgcgtcggctacctc
gacttcgccggcgactccgacaccgccatcgccatccgcaccgccctgctgcgcgacggc
accgcctacgtccaggcgggcgcgggcgtcgtcgccgactccgacccggtcgccgaggac
accgagtgccgcaacaaggcggcggccgtgctgagggccgtacacacggccaaccggctg
gcgcaatag

DBGET integrated database retrieval system