KEGG   Streptomyces coelicolor: SCO2043Help
Entry
SCO2043           CDS       T00085                                 

Gene name
SC4G6.12c, trpE3
Definition
(RefSeq) anthranilate synthase component I
  KO
K01657  
anthranilate synthase component I [EC:4.1.3.27]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Phenazine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Quorum sensing
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO2043 (SC4G6.12c)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2043 (SC4G6.12c)
  Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    SCO2043 (SC4G6.12c)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SCO2043 (SC4G6.12c)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SCO2043 (SC4G6.12c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2192224..2193732)
Genome map
AA seq 502 aa AA seqDB search
MDVTHDMDLDTFRKLAADRRVIPVSRKLLADGDTPVALYRKLAASRPGTFLLESAENGRS
WSRYSFVGVRSAATLTEKDGQAHWQGTPPVGVPTDGDPLAALRATVEALHTPRDLAHDLG
LPPFTGGMVGYLGYDIVRRLEKVGPGERDDLKLPELTMLLTSDLAVMDHWEGSVLLIANA
INHNDLETGVDEAYADAIARLDVMEADLTRAVAQPPAALPPSELPEYTALWGGPDFQDAV
EDIKERIRAGEAFQVVPSQRFETPCTASALDVYRVLRATNPSPYMYLLRLDGFDVVGSSP
EALVKVEDGRAMVHPIAGTRPRGATPREDQSLADELLADPKERAEHLMLVDLGRNDLGRV
CEPGSVEVVDFMSVERYSHVMHIVSTVTGRVAPGRTAFDVLTACFPAGTLSGAPKPRALQ
IIDELEPSRRGLYGGCVGYLDFAGDSDTAIAIRTALLRDGTAYVQAGAGVVADSDPVAED
TECRNKAAAVLRAVHTANRLAQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcacgcatgacatggacctcgacaccttccgcaagctcgccgccgaccgccgg
gtgatcccggtgagccgcaagctcctcgccgacggcgacaccccggtcgcgctgtaccgc
aagctcgccgcctcgcgccccggcaccttcctgctggagtccgcggagaacggacgctcc
tggtccaggtactccttcgtcggcgtccgcagcgccgccaccctcaccgagaaggacggc
caggcgcactggcagggcaccccgcccgtcggcgtccccaccgacggcgacccgctcgcc
gccctgcgcgccaccgtcgaggccctgcacaccccgcgcgacctcgcccacgacctgggc
ctgccgcccttcaccggcggcatggtgggctacctcgggtacgacatcgtgcgccgcctg
gagaaggtcggcccgggggagcgcgacgacctgaagctgcccgagctgaccatgctgctc
accagcgacctcgccgtcatggaccactgggagggctcggtcctgctgatcgccaacgcg
atcaaccacaacgacctggagaccggcgtcgacgaggcctacgccgacgcgatcgcccgc
ctcgacgtcatggaggccgacctcacgcgtgccgtcgcccagcccccggccgcgctgccc
ccctccgagctgcccgagtacaccgcgctgtggggcggccccgacttccaggacgccgtc
gaggacatcaaggagcgcatccgcgcgggcgaggccttccaggtcgtcccctcccagcgc
ttcgagacgccctgcacggcgagcgccctcgacgtctaccgggtcctgcgggccaccaac
ccctccccgtacatgtacctgctccgtctcgacggcttcgacgtcgtcggctcgtccccc
gaggcgctggtcaaggtcgaggacgggcgcgccatggtgcaccccatcgccggtacccgc
ccgcgcggcgccaccccgcgggaggaccagtccctcgccgacgaactgctcgccgacccc
aaggagcgcgccgagcacctgatgctggtcgacctcggccgcaacgacctcgggcgcgtc
tgcgagcccgggtccgtcgaggtcgtcgacttcatgtccgtcgagcggtactcgcacgtc
atgcacatcgtctcgacggtcaccggccgggtcgccccgggccgcaccgccttcgacgtc
ctcaccgcctgcttcccggccggcaccctctccggcgcgcccaagccgcgcgccctgcag
atcatcgacgaactcgagccctcccggcgcggcctgtacggcggctgcgtcggctacctc
gacttcgccggcgactccgacaccgccatcgccatccgcaccgccctgctgcgcgacggc
accgcctacgtccaggcgggcgcgggcgtcgtcgccgactccgacccggtcgccgaggac
accgagtgccgcaacaaggcggcggccgtgctgagggccgtacacacggccaaccggctg
gcgcaatag

DBGET integrated database retrieval system