KEGG   Streptomyces coelicolor: SCO2044Help
Entry
SCO2044           CDS       T00085                                 

Gene name
hisI
Definition
(RefSeq) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
sco  Streptomyces coelicolor
Pathway
sco00340  Histidine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01230  Biosynthesis of amino acids
Module
sco_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SCO2044 (hisI)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     SCO2044 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-GeneID: 1097478
NCBI-ProteinID: NP_626304
Kitasato: SCO2044
UniProt: Q9S2U1
Position
complement(2193744..2194130)
Genome map
AA seq 128 aa AA seqDB search
MTSSSPTGGGPGRPSALAPEIADRLKRSADGLLPAIAQQYDTGEVLMLGWMDDEALHRTL
TTGRCTYWSRSRGEYWVKGDTSGHFQWVKSVALDCDADTVLVKVDQVGAACHTGTRTCFD
TDVLLADQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcagctcccccaccggcggcggccccgggcggcccagcgcgctcgcccccgag
atcgccgaccgcctcaagcgcagcgccgacggcctcctgcccgccatcgcccagcagtac
gacaccggagaggtgctgatgctcggctggatggacgacgaggcgctgcaccgcacgctg
acgaccggccgctgcacctactggtcgcgcagccgcggggagtactgggtcaagggcgac
acctcgggacatttccagtgggtgaagtccgtcgccctggactgcgacgccgacaccgtg
ctcgtcaaggtcgaccaggtgggcgccgcctgccacaccggcacccgcacctgcttcgac
accgacgtgctcctcgcggatcagtag

DBGET integrated database retrieval system