KEGG   Streptomyces coelicolor: SCO2050Help
Entry
SCO2050           CDS       T00085                                 

Gene name
hisA, SC4G6.19c
Definition
(RefSeq) 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC:5.3.1.16)
  KO
K01814  
phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
sco  Streptomyces coelicolor
Pathway
Histidine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO2050 (hisA)
  Amino acid metabolism
   00340 Histidine metabolism
    SCO2050 (hisA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2050 (hisA)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     SCO2050 (hisA)
    5.3.1.24  phosphoribosylanthranilate isomerase
     SCO2050 (hisA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2197966..2198688)
Genome map
AA seq 240 aa AA seqDB search
MSKLELLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGT
GDNRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAE
HGDKIAVGLDVRGTTLRGRGWTRDGGDLYETLDRLNKEGCARYVVTDIAKDGTLQGPNLE
LLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEALEATS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctcgaactcctccccgccgtcgacgtccgcgacggccaggccgtccgcctc
gtgcacggcgagtccggcaccgagacctcctacggctccccgctggaggccgccctcgcc
tggcagcgctccggcgccgagtggctgcacctggtggacctggacgcggcgttcgggacc
ggggacaaccgcgcgctgatcgccgaggtcgcgcaggccatggacatcaaggtggagctg
tccggcggcatccgcgacgacgacaccctcgccgccgcgctcgccaccggctgtacccgg
gtgaacctgggcacggccgccctggagacccccgagtgggtcgccaaggtcatcgccgag
cacggcgacaagatcgcggtcggcctggacgtacggggcaccacgctccgcggccgcggc
tggacccgcgacggcggcgacctctacgagacgctggaccgcctgaacaaggagggctgc
gcccgctacgtcgtcaccgacatcgccaaggacggcaccctccagggccccaacctggag
ctgctgaagaacgtctgcgcggccaccgaccgcccggtcgtggcgtcgggcggcgtctcc
tccctggacgacctgcgcgcgatcgccgggctcgtcccggccggtgtcgagggggccatc
gtcgggaaggccctgtacgcgaaggcgttcaccctggaagaagccttggaggctacgtcg
tga

DBGET integrated database retrieval system