KEGG   Streptomyces coelicolor: SCO2051Help
Entry
SCO2051           CDS       T00085                                 

Gene name
hisH
Definition
(RefSeq) imidazole glycerol phosphate synthase subunit HisH
  KO
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
sco  Streptomyces coelicolor
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO2051 (hisH)
  Amino acid metabolism
   00340 Histidine metabolism
    SCO2051 (hisH)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     SCO2051 (hisH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(2198706..2199374)
Genome map
AA seq 222 aa AA seqDB search
MTAAVPAGATGRAKKVVVFDYGFGNVRSAERALARAGADVEITRDYDKAMNADGLLVPGV
GAFAACMEGLKAARGDWIVDRRLSGGRPVMGICVGMQILFSRGIEHDVEAEGLDEWPGTV
GPLEADVVPHMGWNTVEAPADSQLFAGLDADARFYFVHSYAVHEWTQESHNPLIAEPRVT
WSTHGKPFVAAVENGALWATQFHPEKSGDAGAQLLTNWIETL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgccgcagtccccgccggcgccaccggccgcgccaagaaggtcgtcgtcttcgac
tacggcttcggcaacgtccgctccgccgagcgcgccctcgcgcgcgcgggggccgacgtc
gagatcacccgtgactacgacaaggccatgaacgccgacggactgctggtccccggcgtc
ggcgccttcgccgcctgcatggagggcctcaaggccgcccggggcgactggatcgtcgac
cgccgcctgtccggcgggcgcccggtcatgggcatctgtgtcggcatgcagatcctcttc
tcgcgcggcatcgagcacgacgtggaggccgagggcctggacgagtggcccggcacggtc
ggacccctcgaggccgacgtcgtgccccacatgggctggaacacggtcgaggcaccggcc
gactcccagctcttcgccggcctggacgcggacgcccgcttctacttcgtgcactcctac
gccgtccacgagtggacccaggagtcgcacaacccgctgatcgccgagcccagggtcacc
tggtccacccacggcaagcccttcgtggccgccgtggagaacggtgcgctgtgggccacc
cagttccaccccgagaagtccggcgacgccggagcccagctcctcaccaactggatcgaa
accctctag

DBGET integrated database retrieval system