KEGG   Streptomyces coelicolor: SCO2052Help
Entry
SCO2052           CDS       T00085                                 

Gene name
hisB
Definition
(RefSeq) imidazoleglycerol-phosphate dehydratase
  KO
K01693  
imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
sco  Streptomyces coelicolor
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO2052 (hisB)
  Amino acid metabolism
   00340 Histidine metabolism
    SCO2052 (hisB)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     SCO2052 (hisB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2199539..2200132)
Genome map
AA seq 197 aa AA seqDB search
MSRVGRVERTTKETSVLVEIDLDGTGKTDIATGVGFYDHMLDQLGRHGLFDLTVKTDGDL
HIDSHHTIEDTALALGAAFRQALGDKVGIYRFGNCTVPLDESLAQVTVDLSGRPYLVHTE
PENMAPMIGEYDVTMTRHILESFVAQAQVALHVHVPYGRNAHHIVECQFKALARALRYAS
ERDPRAAGILPSTKGAL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgtagggcgcgtggagcgcaccaccaaggagacctcggtcctcgtcgagatc
gacctcgacggcaccggcaagaccgacatcgccaccggcgtcggcttctacgaccacatg
ctcgaccagctcggccggcacggtctgttcgacctgaccgtgaagaccgacggcgacctg
cacatcgactcccaccacaccatcgaggacaccgccctcgcgctgggcgccgccttcagg
caggccctcggcgacaaggtgggcatctaccgcttcggcaactgcacggtcccgctggac
gagtccctcgcccaggtcaccgtcgacctctccggccgcccctacctcgtgcacaccgag
cccgagaacatggcgccgatgatcggcgagtacgacgtgacgatgacccggcacatcctg
gagtccttcgtcgcccaggcccaggtcgccctgcacgtccacgtgccctacgggcgcaac
gcgcaccacatcgtggagtgccagttcaaggcgctggcccgggccctgcgctacgcctcg
gagcgcgacccgcgcgcggccggcatcctgccttccacgaagggcgcgctgtaa

DBGET integrated database retrieval system