KEGG   Streptomyces coelicolor: SCO2053Help
Entry
SCO2053           CDS       T00085                                 

Gene name
hisC1, SC4G6.22c
Definition
(RefSeq) histidinol-phosphate aminotransferase
  KO
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO2053 (hisC1)
  Amino acid metabolism
   00340 Histidine metabolism
    SCO2053 (hisC1)
   00350 Tyrosine metabolism
    SCO2053 (hisC1)
   00360 Phenylalanine metabolism
    SCO2053 (hisC1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2053 (hisC1)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SCO2053 (hisC1)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     SCO2053 (hisC1)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class II
   SCO2053 (hisC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2200129..2201238)
Genome map
AA seq 369 aa AA seqDB search
MTFGIDDLPVRDELRGKSPYGAPQLDVPVRLNTNENPYPLPEALVERIAERVREAARDLN
RYPDRDAVELRTQLARYLTDTSGHPLDVSNVWAANGSNEVIQQLLQTFGGPGRTAIGFEP
SYSMHGLIARGTGTGWISGPRHEDFTIDVPAATRAIDEHRPDVVFITTPNNPTGTAVPAE
TVLALYEAAQAAKPSMVVVDEAYIEFSHGASLLPLLDGRPNLVVSRTMSKAFGAAGLRLG
YLAAHPAVVDAVQLVRLPYHLSAVTQATALAALEHTDTLLKYVEQLKTERDRLVAELRAI
GYAVTESDANFVQFGRFADSHATWRKILDRGVLVRDNGVPGWLRVTAGTPEENDAFLDAV
REVKKEQHT
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgacgttcggcatcgacgatctccccgtacgggacgagctgcgcggcaagtccccctac
ggcgcgccccaactggacgtgccggtacggctgaacaccaacgagaacccctacccgctg
cccgaggcgctggtcgagcggatcgccgagcgggtccgcgaggccgcccgcgacctcaac
cgctaccccgaccgggacgcggtcgagctgcgcactcaactggcccggtacctgacggac
acctcgggacacccgctggacgtgagcaacgtctgggcggccaacggctccaacgaggtc
atccagcaactgctgcagaccttcggcgggccgggccgcaccgcgatcggcttcgagccg
tcgtactcgatgcacggcctcatcgcgcgcggcaccggcaccggctggatctccgggccg
cgccacgaggacttcaccatcgacgtgcccgccgccacgcgggcgatcgacgagcaccgc
ccggacgtcgtcttcatcaccacccccaacaaccccacgggaaccgcggtcccggccgag
acggtcctcgccctgtacgaggccgcccaggcggcgaagccgtccatggtcgtggtggac
gaggcgtacatcgagttcagccacggcgcctcgctgctgccgctgctcgacgggcggccg
aacctcgtcgtctcccgcacgatgtcgaaggcgttcggcgcggcgggcctgcgcctcggc
tacctggccgcgcacccggccgtcgtcgacgcggtccagctcgtacggctgccgtaccac
ctgtcggccgtgacgcaggcgaccgcgctggccgccctggagcacacggacacgctgctg
aagtacgtcgagcagctgaagaccgagcgggaccggctggtcgccgaactgcgcgccatc
ggctacgcggtgaccgagtccgacgcgaacttcgtccagttcgggcggttcgcggactcc
cacgcgacctggcggaagatcctcgaccggggcgtcctggtccgggacaacggcgtgccg
gggtggctgcgggtcaccgccggcactccggaggagaacgacgcgttcctcgacgcggta
cgtgaagtcaagaaggagcagcacacatga

DBGET integrated database retrieval system