KEGG   Streptomyces coelicolor: SCO2073Help
Entry
SCO2073           CDS       T00085                                 

Gene name
SC4A10.06c
Definition
(RefSeq) ribosomal large subunit pseudouridine synthase
  KO
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sco  Streptomyces coelicolor
Brite
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SCO2073 (SC4A10.06c)
Ribosome biogenesis [BR:sco03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    SCO2073 (SC4A10.06c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2224211..2225155)
Genome map
AA seq 314 aa AA seqDB search
MSTIPEIRTLPVPDGLEGERVDAAISRMFGFSRTKAAELAAAGKVQVDGSVVGKSERVHG
GAWLEVEMPQAPAPVQVVAEPVEGMEIVHDDEDVVVVVKPVGVAAHPSPGWSGPTVIGGL
AAAGYRVSTSGAAERQGIVHRLDVGTSGLMAVAKSERAYTSLKRQFKERTVDKRYHTLVQ
GHPDPTSGTIDAPIGRHPQHDYKWAVTAEGKPSVTHYDLIEAFRAASLLDVKLETGRTHQ
IRVHMAAHRHPCVGDLTYGADPTLAKRLRLTRQWLHAVRLGFEHPGTGDWVEYASEYPDD
LQQALDLVREETYG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgattcccgagatccgtaccctgcccgtgccggacggcctggagggcgagcgc
gtcgacgccgccatctcccgcatgttcggcttctcccgtaccaaggccgcggagctcgcc
gcggcgggcaaggtgcaggtcgacggatcggtggtcggcaagtccgagcgcgtccacggc
ggtgcctggctcgaggtcgagatgccgcaggcgcccgctcccgtgcaggtggtcgccgag
cccgtcgagggcatggagatcgtgcacgacgacgaggacgtggtcgtcgtcgtcaagccg
gtgggcgtcgcggcgcatccgtcgccggggtggagcgggccgaccgtcatcggcggactg
gccgccgccgggtaccgcgtctccacctccggcgccgccgagcgccagggcatcgtgcac
cgcctcgacgtcggcacctccggtctgatggcggtggccaagtcggagcgcgcctacacc
tcgctcaagcgccagttcaaggagcgcacggtcgacaagcgctaccacacgctcgtacag
ggccaccccgacccgaccagcggcaccatcgacgcccccatcggccgccacccgcagcac
gactacaagtgggccgtcaccgccgagggcaagccctccgtcacgcactacgacctcatc
gaggccttccgcgccgcctccctgctcgacgtgaagctggagaccggccgcacccaccag
atccgcgtccacatggcagcccaccgccacccctgcgtcggcgacctgacctacggcgcg
gaccccaccctcgccaagcggctgcggctgacccgccagtggctgcacgccgtgcggctc
ggcttcgagcaccccggcaccggcgactgggtggagtacgccagcgaatatcccgacgac
ctccagcaggccctcgacctggtgcgcgaggagacctacggatga

DBGET integrated database retrieval system