KEGG   Streptomyces coelicolor: SCO2103Help
Entry
SCO2103           CDS       T00085                                 

Gene name
metF, SC4A10.36c
Definition
(RefSeq) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  
methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
sco  Streptomyces coelicolor
Pathway
One carbon pool by folate
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO2103 (metF)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SCO2103 (metF)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     SCO2103 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2260993..2261916)
Genome map
AA seq 307 aa AA seqDB search
MALGTASTRTDRARTVRDILATGKTTYSFEFSAPKTPKGERNLWSALRRVEAVAPDFVSV
TYGAGGSTRAGTVRETQQIVADTTLTPVAHLTAVDHSVAELRNIIGQYADAGIRNMLAVR
GDPPGDPNADWIAHPEGLTYAAELVRLIKESGDFCVGVAAFPEMHPRSADWDTDVTNFVD
KCRAGADYAITQMFFQPDSYLRLRDRVAAAGCATPVIPEVMPVTSVKMLERLPKLSNASF
PAELKERILTAKDDPAAVRSIGIEFATEFCARLLAEGVPGLHFITLNNSTATLEIYENLG
LHHPPRA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggccctcggaaccgcaagcacgaggacggatcgcgcccgcacggtgcgtgacatcctc
gccaccggcaagacgacgtactcgttcgagttctcggcgccgaagacgcccaagggcgag
aggaacctctggagcgcgctgcggcgggtcgaggccgtggccccggacttcgtctccgtg
acctacggcgccggcggctccacgcgcgccggcacggtccgcgagacccagcagatcgtc
gccgacaccacgctgaccccggtggcccacctcaccgccgtcgaccactccgtcgccgag
ctgcgcaacatcatcggccagtacgccgacgccgggatccgcaacatgctggccgtgcgc
ggcgacccgcccggcgacccgaacgccgactggatcgcgcaccccgagggcctgacctac
gcggccgaactggtcaggctcatcaaggagtcgggcgacttctgcgtcggcgtcgcggcc
ttccccgagatgcacccgcgctccgccgactgggacacggacgtcacgaacttcgtcgac
aagtgccgggccggcgccgactacgccatcacccagatgttcttccagcccgactcctat
ctccggctgcgcgaccgggtcgccgcggccggctgcgcgaccccggtcatccccgaggtc
atgccggtgaccagtgtgaagatgctggagaggttgccgaagctcagcaacgcctcgttc
ccggcggagttgaaagagcggatcctcacagccaaggacgatccggcggctgtacgctcg
atcggcatcgagttcgccacggagttctgcgcgcggctgctggccgagggagtgccagga
ctgcacttcatcacgctcaacaactccacggcgacgctggaaatctacgagaacctgggc
ctgcaccacccaccgcgggcctag

DBGET integrated database retrieval system