KEGG   Streptomyces coelicolor: SCO2115Help
Entry
SCO2115           CDS       T00085                                 

Gene name
aroH, SC6E10.09c
Definition
(RefSeq) 2-dehydro-3-deoxyphosphoheptonate aldolase
  KO
K01626  
3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Quorum sensing
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO2115 (aroH)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2115 (aroH)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SCO2115 (aroH)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     SCO2115 (aroH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2272073..2273425)
Genome map
AA seq 450 aa AA seqDB search
MTVNAKTSPSAGNTWRDLPAAQQPEYPDTEALRAVIADLESYPPLVFAGECDQLRARMAA
VAKGEAFLLQGGDCAEAFDAVSADHIRNKLKTLLQMGAVLTYAASVPVVKVGRIAGQYSK
PRSKPTETRDGVTLPTYRGDSVNGFDFTEAARIPDPERLKRMYHASASTLNLVRAFTTGG
YADLRQVHAWNQDFVKSSPSGQRYEQLAREIDNALNFMRACGTDPAEFQTVEFFSSHEAL
LLDYESALTRVDSRTGQLYDVSGHMVWIGERTRQLDHAHIEFASRIRNPIGIKLGPSTTA
EEALQYIERLDPEREPGRLTFIVRMGADKIRDKLPELVEKVTASGATVAWITDPMHGNTY
EAASGHKTRRFDDVLDEVKGFFEVHKSLGTHPGGIHVELTGDDVTECVGGGDEIFVDDLH
QRYETACDPRLNRSQSLDLAFLVAEMYRDQ
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgaacgctaagaccagcccgagcgctggcaacacctggcgagacctgcccgcg
gcgcagcagcccgagtaccccgacaccgaggctctgcgcgcagtgatcgcggacctcgag
tcgtatccgccgctcgtcttcgcgggcgagtgcgaccagctgcgcgcccggatggcggcc
gtcgccaagggagaggcgttcctcctccagggcggcgactgcgccgaggccttcgacgcg
gtgtccgcggaccacatccgcaacaagctcaagaccctcctccagatgggcgccgtcctc
acctacgccgcgtccgtgcccgtggtgaaggtcggccggatcgccgggcagtactccaag
ccccgctccaagccgaccgagacccgcgacggcgtgacgctgccgacctaccgcggcgac
tccgtcaacggcttcgacttcaccgaggcggcccggatcccggaccccgagcggctcaag
cgcatgtaccacgcctcggcgtccacgctgaacctggtgcgcgccttcaccaccggcggc
tacgccgacctgcgccaggtgcacgcctggaaccaggacttcgtgaagtcgtccccctcc
ggccagcgctacgagcagctcgcccgggagatcgacaacgcgctgaacttcatgcgggcc
tgcggcacggacccggccgagttccagaccgtcgagttcttctcctcgcacgaggcgctg
ctgctcgactacgagtcggccctcacccgcgtcgactcgcgcaccgggcagctgtacgac
gtctccggccacatggtgtggatcggtgagcgcacccggcagctggaccacgcgcacatc
gagttcgcctcgcggatccgcaacccgatcggcatcaagctcggcccgtccaccacggcc
gaggaggcgctgcagtacatcgagcggctggacccggagcgcgagcccgggcggctgacc
ttcatcgtccggatgggcgcggacaagatccgcgacaagctcccggagctggtggagaag
gtcaccgcctccggcgccaccgtcgcctggatcaccgacccgatgcacggcaacacctac
gaggcggcctccggtcacaagacccgccgcttcgacgacgtgctcgacgaggtcaagggc
ttcttcgaggtgcacaagtcgctcggcacccacccgggcggcatccacgtggaactgacc
ggcgacgacgtcaccgagtgcgtgggcggcggcgacgagatcttcgtggacgacctgcac
cagcgctacgagacggcctgcgacccgcggctcaaccgcagccagtcgctcgacctggcg
ttcctggtggcggagatgtaccgggaccagtga

DBGET integrated database retrieval system