KEGG   Streptomyces coelicolor: SCO2145Help
Entry
SCO2145           CDS       T00085                                 

Gene name
SC6G10.18
Definition
(RefSeq) glycerate kinase
  KO
K00865  
glycerate 2-kinase [EC:2.7.1.165]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Glycerolipid metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO2145 (SC6G10.18)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SCO2145 (SC6G10.18)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO2145 (SC6G10.18)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     SCO2145 (SC6G10.18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
2305901..2307199
Genome map
AA seq 432 aa AA seqDB search
MSHPSPVLNRVVVAPSGFKESLSARAAADAIAAGVRRVLPDAEIDRIPLVDGGEGTAVAL
ASATGGRLVALAATGPVGDRVGTHFALLGTGDTAVVEMAAVAGLSLVPRALRDPGATTTY
GVGELIRAALGTGVRRVLVGCGDSGTSDGGAGALQALGARLLDGDGFELGPGGRELNRLV
RVDPSGLDARLKDTELLVACNPYNVLCGERGVARVFGPQKGATPAQVEELSAGLENWARV
LTRDLGVVGTDLRTGSGTGASGGLGAGLAAVGARLLPRFDVLLGHLDLDARLARADLVLT
AEGALDHQTPRGKVPAEVARRAKLSGRPVLALAGTLGEGAHDVPGVDACHGIMPAPMALA
DALLRASELLTDATERALRMVLLGARLPAGPAQAAVPVTGAVPRDAGSPDAWSPDAVSPD
AGSGTQRPSSVR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatccgtcccccgtgctgaaccgagtggtcgtggcccccagcggattcaaggag
tccctgtccgcccgcgccgccgccgacgccatcgcggcgggcgtccgccgggtgctgccg
gacgccgagatcgaccggatcccgctcgtggacggcggcgagggcaccgccgtcgcgctg
gcgtccgcgaccggcgggcggctggtggcgctggccgccaccggtccggtcggcgaccgg
gtcggcacccacttcgcgctgctcggcaccggggacacggcggtggtggagatggcggcc
gtcgcgggcctgtccctggtcccccgcgctctgcgcgaccccggcgccaccaccacgtac
ggcgtcggcgagctgatccgcgccgctctcggcaccggggtgcggcgcgtgctggtcggc
tgcggcgactcggggacgtccgacgggggcgcgggcgcgctccaggcgctcggggcccgg
ctgctggacggggacggcttcgaactcggacccggcggacgggagctgaaccgcctcgtc
cgcgtcgacccgtccggcctcgacgcccggctgaaggacaccgagctgctcgtcgcctgc
aacccctacaacgtgctgtgcggcgagcggggcgtggcccgggtgttcggcccgcagaag
ggggcgacgcccgcgcaggtcgaggagttgtcggccgggctggagaactgggcgcgcgtg
ctcacccgcgacctcggcgtcgtcggcaccgacctgcgcacggggtccggcaccggcgcg
tccggcggtctcggcgcgggactcgccgccgtcggggcccggctgctgccccgcttcgac
gtgctcctgggccacctcgacctggacgcccgcctcgcccgggccgacctggtgctcacc
gccgagggagccctggaccaccagacgccgcgcggcaaggtgccggccgaggtggcccgc
cgcgccaagctctccggcaggcccgtcctcgccctggcgggcacgctcggcgagggcgcg
cacgacgtgcccggggtggacgcctgccacgggatcatgccggcgccgatggccctggcg
gacgcgttgctgcgcgcctccgagctcctcacggacgccacggaacgggcgctgcggatg
gtgctgctgggggcccggttgccggccgggccggctcaggcggcggtgccggtcaccggt
gccgtcccgcgggacgccgggtcgccggacgcgtggtcgccggacgccgtgtcgccggac
gccgggtcgggcacgcagcggccgtcctcggtgcggtag

DBGET integrated database retrieval system