KEGG   Streptomyces coelicolor: SCO2147Help
Entry
SCO2147           CDS       T00085                                 

Gene name
trpD
Definition
(RefSeq) anthranilate phosphoribosyltransferase
  KO
K00766  
anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2147 (trpD)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     SCO2147 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2308851..2309915)
Genome map
AA seq 354 aa AA seqDB search
MSAVTPAGGDTTADRSWPALLNGLLDGRDLSADDTAWALDVIMRGEATDVQIAGFAVGLR
FKGETVEEISGLVRTMYEHANVIEVPGKTVDIVGTGGDGAKTVNISTMSAIVLAGTGAKV
VKHGNRAASSASGASDVLEKLGVNLELTPQRVAEVAEEAGITFCFAVKFHPALRHVATAR
GQLGIRTVFNFLGPLTNPARVKAQAVGVAHARMAPIVAGVFAERGHSSLVFRGDDGLDEL
TTTSTSRVWVVRDGRVTEETFDPRDVGIELVPVEALRGADASYNADVARRLLAGEKGPVR
DAVLLNSAAALEALEPGEGALAERLRAGMDRAAEAIDSGAARRVLERWVAVSHA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgtgacccccgctggaggcgacaccacggcggaccgctcctggcccgccctg
ctgaacggactgctggacggccgcgacctgagcgcggacgacaccgcctgggcgctggac
gtgatcatgcgcggcgaggcgaccgacgtgcagatcgccgggttcgcggtgggcctgcgg
ttcaagggggagacggtcgaggagatctccggactggtccgcaccatgtacgaacacgcc
aacgtgatcgaggtgccggggaagaccgtcgacatcgtcggcaccggcggcgacggcgcc
aagacggtcaacatctccaccatgtcggcgatcgtcctggccggcacgggggcgaaggtc
gtcaagcacggcaaccgggccgcctcctcggcgtccggggcctccgacgtcctggagaag
ctcggggtcaacctggagctgacgccgcagcgggtggcggaggtcgccgaggaagccggc
atcaccttctgcttcgccgtgaagttccacccggcgctgcgccacgtggcgacggcccgc
ggtcagctcggcatccgtacggtgttcaacttcctgggtccgctgaccaaccccgcccgg
gtgaaggcccaggcggtcggggtcgcccacgcccggatggcgccgatcgtcgccggtgtc
ttcgccgagcgcggccactcgtccctggtcttccgcggcgacgacggactcgacgagctg
accacgacctccacctcccgggtctgggtcgtgcgcgacggccgggtgaccgaggagacc
ttcgacccgcgcgacgtcggcatcgagctggtgccggtcgaggcgctgcgcggggccgac
gcctcctacaacgccgacgtcgcccgccgcctgctggccggcgagaagggtccggtgcgg
gacgcggtcctgctgaactcggcggcggccctggaggccctggagcccggcgagggggcg
ctggccgagcggctgcgggccgggatggaccgggcggccgaggcgatcgactccggggcg
gcccggcgggtgctggagcgctgggtggccgtgagccacgcgtag

DBGET integrated database retrieval system