KEGG   Streptomyces coelicolor: SCO2150Help
Entry
SCO2150           CDS       T00085                                 

Gene name
qcrC, SC6G10.23c
Definition
(RefSeq) cytochrome C heme-binding subunit
  KO
K03889  
ubiquinol-cytochrome c reductase cytochrome c subunit
Organism
sco  Streptomyces coelicolor
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    SCO2150 (qcrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2312739..2313548)
Genome map
AA seq 269 aa AA seqDB search
MKKLSARRRHPLAALVVLLLALACTGGLYAAFAPASKAQADESAQSLAIDEGKKLYAVGC
ASCHGTGGQGTSDGPSLVGVGAAAVDFQVGTGRMPAQQPGAQVPKKKVIYSQAEIDQLAA
YIASLGAGPAIPSEEKYGPEGADIAKGGELFRTNCAQCHNFTGKGGALTHGKYAPSLEGV
DPKHIYEAMQTGPQNMPSFPDTTLSEQNKKDIIAYLDAVNGDDTESPGGLSLGGLGPVSE
GLFAWVFGLGALIAVAVWVAARTAKAKKS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagctctccgcacgacgacgccatccgctggcggccctcgtcgtcctactcctc
gcgctggcatgcacaggggggctgtacgccgcgttcgcacccgcgagcaaggcgcaggcc
gatgaatccgcccagtccctcgccatcgacgagggcaagaagctctacgccgtcggctgt
gccagttgccacggcaccggagggcagggcaccagtgacggtccgagcctggtcggcgta
ggcgccgcggccgtcgacttccaggtgggcaccggccgcatgccggcccagcagcccggc
gcgcaggtcccgaagaagaaggtcatctactcccaggcggagatcgaccagctcgcggcg
tacatcgcgtcgctgggcgccggtccggcgatcccctcggaggagaagtacggccccgag
ggcgcggacatcgccaagggtggtgagctgttccgcaccaactgcgcgcagtgccacaac
ttcaccggcaagggcggcgccctgacgcacggcaagtacgcgccgagcctcgagggtgtc
gacccgaagcacatctacgaggccatgcagaccggcccgcagaacatgccctccttcccc
gacaccacgctgtcggagcagaacaagaaggacatcatcgcctacctggacgcggtcaac
ggtgacgacaccgagagccccggtggtctcagcctcggcggactcggcccggtcagtgag
ggtctgttcgcctgggtgttcggactgggcgcgctgatcgccgtcgccgtctgggtcgcc
gctcggaccgcaaaggccaagaagtcatga

DBGET integrated database retrieval system