KEGG   Streptomyces coelicolor: SCO2180Help
Entry
SCO2180           CDS       T00085                                 

Gene name
pdhL, SC5F7.21
Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00020  Citrate cycle (TCA cycle)
sco00260  Glycine, serine and threonine metabolism
sco00280  Valine, leucine and isoleucine degradation
sco00620  Pyruvate metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco00640  Propanoate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO2180 (pdhL)
   00020 Citrate cycle (TCA cycle)
    SCO2180 (pdhL)
   00620 Pyruvate metabolism
    SCO2180 (pdhL)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO2180 (pdhL)
   00640 Propanoate metabolism
    SCO2180 (pdhL)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO2180 (pdhL)
   00280 Valine, leucine and isoleucine degradation
    SCO2180 (pdhL)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SCO2180 (pdhL)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SCO2180 (pdhL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA HI0933_like FAD_oxidored FAD_binding_2 AlaDh_PNT_C NAD_binding_8 T2SS-T3SS_pil_N DAO Thi4 Trp_halogenase 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 1097613
NCBI-ProteinID: NP_626433
Kitasato: SCO2180
UniProt: Q9S2Q6
Position
2344272..2345732
Genome map
AA seq 486 aa AA seqDB search
MSGRTPAADRSLETGVAHMHGGRDVANDASTVFDLVILGGGSGGYAAALRGAQLGLDVAL
IEKNKLGGTCLHNGCIPTKALLHAGEVADQSRESEQFGVKTSFEGVDMAGVHKYKDEVIA
GLYKGLQGLVASRKITYIEGEGRLSSPTSVDVNGQRVQGRHVLLATGSVPKTLPGLEIDG
NRIISSDHALTLDRVPKSAIVLGGGVIGVEFASAWKSFGSEVTVIEGLKHLVPVEDENSS
KLLERAFRKRGIKFNLGTFFQKAEYTQDGVKVTLADGKEFEAEVLLVAIGRGPVSQGLGY
EENGVATDRGFVLVDEYMRTNVPTISAVGDLVPTLQLAHVGFAEGILVAERLAGLKTVPV
DYDGVPRVTYCHPEVASVGLTEARAKEVYGADKVVSIKFPLGGNGKSRILKTAGEIKLVQ
VKDGAVVGVHMVGDRMGEQVGEAQLIYNWEALPAEVAQLIHAHPTQNEALGEAHLALAGK
PLHMHD
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagcggccggacaccagccgccgaccggtcactggagaccggcgtggcgcacatgcat
ggaggacgtgacgtggcgaacgacgccagcaccgttttcgacctagtgatcctcggcggt
ggcagcggtggttacgccgcggccctgcgcggggcgcagctgggcctggacgtcgccctg
atcgagaagaacaagctcggcggcacctgccttcacaacggttgcattcccaccaaggcc
ctgctccacgcgggcgaggtcgccgaccagtcccgcgagagcgagcagttcggcgtcaag
acgtccttcgagggcgtcgacatggccggcgtgcacaagtacaaggacgaggtgatcgcc
ggcctgtacaagggcctgcagggtctggtcgcctcccgcaagatcacctacatcgagggt
gagggccggctctcctcccccacctcggtggacgtcaacggccagcgtgtccagggccgc
cacgtcctgctggcgaccggctccgtgccgaagaccctgccgggcctggagatcgacggc
aaccggatcatctcctcggaccacgccctcacgctcgaccgcgtgccgaagtccgcgatc
gtgctgggcggcggcgtcatcggcgtcgagttcgcctccgcgtggaagtccttcggttcc
gaggtcacggtcatcgagggcctcaagcacctcgttccggtcgaggacgagaacagctcc
aagctcctggagcgcgccttccgcaagcggggcatcaagttcaacctgggcaccttcttc
cagaaggccgagtacacccaggacggcgtcaaggtcaccctcgccgacggcaaggagttc
gaggccgaggtcctgctcgtcgccatcggccgcggccccgtctcgcagggcctgggctac
gaggagaacggcgtcgcgacggaccgcggcttcgtcctcgtcgacgagtacatgcggacc
aacgtcccgaccatctccgccgtcggtgacctcgttcccaccctccagctcgcgcacgtc
ggcttcgccgagggcatcctggtggcggagcggctcgccggcctgaagaccgtgccggtc
gactatgacggcgtgccgcgggtgacgtactgccacccggaggtcgcctccgtcggtctc
accgaggccagggccaaggaggtctacggcgcggacaaggtcgtctcgatcaagttcccg
ctgggcggcaacggcaagagccgcatcctgaagaccgcgggcgagatcaagctggtccag
gtcaaggacggcgccgtggtcggcgtccacatggtcggcgaccgcatgggcgagcaggtc
ggcgaggcgcagctgatctacaactgggaggcgctgccggccgaggtggcccagctcatc
cacgcccacccgacgcagaacgaggcgctcggcgaggcccacctggcgctggccggcaag
ccgctccacatgcacgactga

DBGET integrated database retrieval system