KEGG   Streptomyces coelicolor: SCO2183Help
Entry
SCO2183           CDS       T00085                                 

Gene name
aceE1, SC5F7.18
Definition
(RefSeq) 2-oxoacid dehydrogenase subunit E1
  KO
K00163  
pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO2183 (aceE1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO2183 (aceE1)
   00020 Citrate cycle (TCA cycle)
    SCO2183 (aceE1)
   00620 Pyruvate metabolism
    SCO2183 (aceE1)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SCO2183 (aceE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
2348740..2351439
Genome map
AA seq 899 aa AA seqDB search
MTTDPKAIQPSELDQLPDRDPEETAEWQASLDAVTQAAGPHRAAYLMRRTLERAEGAGLA
LPKLLETDYVNSIPTADEPTVDGDEAMEQRITAWNRWNAAAMVTRGSKYGVGGHIATFAS
AAWLYETGFNHFFKGKEGDGSGDQLYIQGHASPGIYARAFLDGRLNEEQLDNFRREAGGN
GLPSYPHPRRLPWLWEFPTVSMGLGPISAIYQARFNRYLTSRGIKDLTNSHVWAFLGDGE
MDEPESTTALTLASREGLDNLTFVINCNLQRLDGPVRANFKIVQELEAQFRGAGWNVIKS
LWGTAWDELFQLDTTGALVRRLREVPDAQVQTYQTRDAAYIREDFFNKDPQLAEMAKLLS
DDKILDCFHFSRGGHESRKVYAAYRAALAHKGAPTVILAQTVKGHTLGRGFASKNANHQM
KKLSVDEFKDMRDLLGLPIADSAFVDGVVPYGHPGADSPEVRYLQERRAALGGPAPARRV
HPLAPLPAPADKAFASFDKGSGSQNVATTMAFVRLVKDLVRDKETGKRWVPIVPDEARTF
GMESLFPSLGIYSPKGQTYEPVDRDQLMYYKEAKNGQILNEGITEAGSMADFIAASTAYA
THGEAMIPFYIFYSMFGWQRTADQMWQLGDQLGRGFLVGATAGRTTLTGEGLQHADGHSP
AIAATNPAALSYDPAFAYEIAAIVKDGLRRMYGEAAPGEDPNVFYYLTVYNEPMPQPAKP
SGVDEGIVKGLYRFNTAETAGLTPAANAPRIQLLGSGTAIHWTLKAQRLLAEEWGVAADV
WSATSWTELRRDAMDADAALLRGEDRVPYVRRALQGAEGPVLAVSDYMRQVPDQIAQWVE
QDYSSLGADGFGLSDTRDAARRHFGVDAESIVVAALAQLARRGEVKATAVKEARERYGL
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacccgaaagccatccagccgagcgagctcgaccagctcccggaccgcgac
cccgaggagaccgccgagtggcaggcctccctggacgccgtcacccaggcggccgggccg
caccgtgccgcgtacctgatgcgccgcacgctggagcgcgccgagggcgcgggcctggcg
ctgcccaagctgctggagaccgactacgtcaactccatcccgaccgccgacgagcccacc
gtggacggcgacgaggcgatggagcagcggatcaccgcctggaaccgctggaacgcggcg
gcgatggtgacccgcggcagcaagtacggcgtcggcggccacatcgccaccttcgcctcc
gcggcctggctctacgagaccggcttcaaccacttcttcaagggcaaggagggtgacggc
tccggcgaccagctctacatccagggccacgcctcccccggcatctacgcccgcgccttc
ctcgacggccgcctgaacgaggagcagctggacaacttccgccgcgaggccggcggcaac
ggcctgccgtcctacccgcacccgcgccgcctgccctggctgtgggagttccccaccgtc
tccatgggcctcggcccgatctccgcgatctaccaggcgcggttcaaccgctacctgacc
agccgcgggatcaaggacctgaccaactcccacgtgtgggcgttcctcggcgacggcgag
atggacgagccggagtccaccaccgcgctcaccctcgcctcccgcgagggcctggacaac
ctgaccttcgtcatcaactgcaacctgcagcgcctcgacggtccggtccgcgccaacttc
aagatcgtgcaggagctggaggcccagttccgcggcgccggctggaacgtgatcaagtcg
ctgtggggcacggcctgggacgagctgttccagctcgacaccaccggcgccctggtacgc
cgcctgcgcgaggtaccggacgcccaggtccagacgtaccagacccgcgacgccgcctac
atccgcgaggacttcttcaacaaggacccgcagctcgccgagatggcgaagctcctgtcc
gacgacaagatcctcgactgcttccacttctcccgcggcggtcacgagtcccgcaaggtg
tacgccgcctaccgcgccgcgctcgcccacaagggcgcgcccaccgtgatcctggcccag
acggtcaagggccacaccctcggccgcggcttcgcctccaagaacgccaaccaccagatg
aagaagctctcggtggacgagttcaaggacatgcgcgacctgctcggcctgccgatcgcg
gacagcgccttcgtcgacggcgtggtcccctacggccacccgggcgccgactcccccgag
gtgcgctacctccaggagcgccgcgccgccctcggcggtcccgccccggcccgccgcgtg
caccccctcgcaccgctgcccgccccggccgacaaggcgttcgcgtccttcgacaagggc
tccggctcgcagaacgtggcgacgaccatggccttcgtccgcctggtcaaggacctggtc
cgcgacaaggagaccggcaagcgctgggtgccgatcgtccccgacgaggcccgcaccttc
ggcatggagagcctcttcccgtccctgggcatctactcgcccaagggccagacgtacgag
ccggtcgaccgcgaccagctgatgtactacaaggaagccaagaacggccagatcctcaac
gagggcatcaccgaggccggctcgatggccgacttcatcgccgcgtccaccgcgtacgcg
acgcacggcgaggcgatgatcccgttctacatcttctactcgatgttcggctggcagcgc
acggccgaccagatgtggcagctcggcgaccagctcggccgcggcttcctggtgggcgcc
accgcgggccgcaccaccctcaccggtgaaggccttcagcacgcggacggccactccccc
gccatcgcggcgaccaaccccgccgccctctcctacgacccggcgttcgcgtacgagatc
gcggcgatcgtcaaggacggtctgcgccgcatgtacggcgaggcggccccgggcgaggac
ccgaacgtcttctactacctgacggtctacaacgagccgatgccgcagccggccaagccg
tccggtgtggacgagggcatcgtcaagggcctgtaccgcttcaacacggcggagacggcg
ggtctgaccccggccgcgaacgccccgcgcatccagctgctcggctccggcacggcgatc
cactggacgctcaaggcgcagcggctgctcgccgaggagtggggcgtggccgccgacgtg
tggtccgcgacctcctggacggagctgcgccgggacgccatggacgccgacgcggcgctg
ctgcgcggcgaggaccgggtgccgtacgtccgtcgggcgctgcagggcgccgagggcccg
gtgctcgcggtctccgactacatgcgccaggtcccggaccagatcgcgcagtgggtcgag
caggactactcgtcgctcggtgccgacggcttcggcctgtcggacacccgggacgccgcc
cgccgccacttcggcgtggacgccgagtccatcgtggtcgcggcgctggcccagctcgcc
cggcgcggcgaggtcaaggcgacggccgtgaaggaggcgcgcgagcgctacggcctgtag

DBGET integrated database retrieval system