KEGG   Streptomyces coelicolor: SCO2198Help
Entry
SCO2198           CDS       T00085                                 

Gene name
glnA, SC3H12.06
Definition
(RefSeq) glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00220  Arginine biosynthesis
sco00250  Alanine, aspartate and glutamate metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco00910  Nitrogen metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01230  Biosynthesis of amino acids
sco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO2198 (glnA)
  Energy metabolism
   00910 Nitrogen metabolism
    SCO2198 (glnA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO2198 (glnA)
   00220 Arginine biosynthesis
    SCO2198 (glnA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCO2198 (glnA)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     SCO2198 (glnA)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO2198 (glnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N
Motif
Other DBs
NCBI-GeneID: 1097631
NCBI-ProteinID: NP_626450
Kitasato: SCO2198
UniProt: P15106
Position
2364905..2366314
Genome map
AA seq 469 aa AA seqDB search
MFQNADDVKKFIADEDVKFVDVRFCDLPGVMQHFTLPATAFDPDAEQAFDGSSIRGFQAI
HESDMSLRPDLSTARVDPFRRDKTLNINFFIHDPITGEQYSRDPRNVAKKAEAYLASTGI
ADTAFFGPEAEFYVFDSVRFATRENESFYHIDSEAGAWNTGALEDNRGYKVRYKGGYFPV
PPVDHFADLRAEISLELERSGLQVERQHHEVGTAGQAEINYKFNTLLAAADDLQLFKYIV
KNVAWKNGKTATFMPKPIFGDNGSGMHVHQSLWSGGEPLFYDEQGYAGLSDTARYYIGGI
LKHAPSLLAFTNPTVNSYHRLVPGFEAPVNLVYSQRNRSAAMRIPITGSNPKAKRVEFRA
PDASGNPYLAFSALLLAGLDGIKNKIEPAEPIDKDLYELAPEEHANVAQVPTSLGAVLDR
LEADHEFLLQGDVFTPDLIETWIDFKRANEIAPLQLRPHPHEFEMYFDV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgttccagaacgccgacgacgtcaagaagttcatcgcggacgaggacgtcaagttcgtc
gatgtccggttctgcgacctgccgggcgtcatgcagcacttcacgctgcccgccacggcg
ttcgaccccgacgccgagcaggccttcgacgggtcctcgatccgcggcttccaggccatc
cacgagtcggacatgtccctgcgccccgacctgtccaccgcgcgcgtcgacccgttccgc
cgggacaagaccctcaacatcaacttcttcatccacgacccgatcacgggcgagcagtac
tcccgcgacccgcggaacgtggcgaagaaggccgaggcgtacctggcctccacgggcatc
gccgacacggcgttcttcggtcccgaggccgagttctacgtcttcgactccgtccgcttc
gccacccgcgagaacgagtccttctaccacatcgactccgaggccggcgcctggaacacc
ggtgcgctggaggacaaccgcggttacaaggtccgctacaagggcggctacttcccggtc
ccgccggtcgaccacttcgccgacctgcgcgccgagatctccctggagctggagcggtcc
ggcctccaggtcgagcgccagcaccacgaggtgggcaccgcgggccaggcggagatcaac
tacaagttcaacactctgctcgcggccgcggacgacctccagctcttcaagtacatcgtg
aagaacgtggcctggaagaacggcaagacggcgaccttcatgccgaagccgatcttcggt
gacaacggctcgggcatgcacgtccaccagtcgctgtggtcgggcggcgagccgctcttc
tacgacgagcagggctacgccggcctgtcggacaccgcccgctactacatcggcggcatc
ctcaagcacgccccgtcgctgctggccttcaccaacccgacggtgaactcgtaccaccgc
ctggtgccgggcttcgaggcgccggtgaacctggtgtactcgcagcgcaaccgctcggcc
gcgatgcggatcccgatcacgggctcgaacccgaaggccaagcgcgtcgagttccgcgcc
ccggacgcctccggcaacccgtacctggcgttctcggcgctgctgctggcgggcctggac
ggcatcaagaacaagatcgagccggccgagccgatcgacaaggacctctacgagctggct
cccgaggagcacgcgaacgtggcgcaggtcccgacctcgctgggcgcggtcctcgaccgc
ctggaggccgaccacgagttcctgctccagggcgacgtgttcacgccggacctgatcgag
acgtggatcgacttcaagcgcgccaacgagatcgcgccgctgcagctgcgtccgcacccg
cacgagttcgagatgtacttcgacgtgtga

DBGET integrated database retrieval system