KEGG   Streptomyces coelicolor: SCO2256Help
Entry
SCO2256           CDS       T00085                                 

Gene name
panB
Definition
(RefSeq) 3-methyl-2-oxobutanoate hydroxymethyltransferase
  KO
K00606  
3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
sco  Streptomyces coelicolor
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO2256 (panB)
Enzymes [BR:sco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     SCO2256 (panB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
2423298..2424173
Genome map
AA seq 291 aa AA seqDB search
MTQLSAAQTPQPKPADGNRALYGGKINRRITVRDITAAKERGEKWPMLTAYDAMTASVFD
ESGIPVMLVGDSAGNCHLGYETTVPVTLDEMTMLSAAVVRGTSRALIVGDLPFGSYQEGP
VQALRSATRLVKEAGVGAVKLEGGERSHRQIELLVESGIPVMAHIGLTPQSVNSMGYRVQ
GRGEEAAQQLLRDAKAVQDAGAFAVVLELVPAELAAEVTRTLHIPTVGIGAGPDTDAQVL
VWTDMLGLTGGRMPKFVKQYADLRKVMGDAAKAYAEDVVGGTFPADEHSVH
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagctttcggctgcccagacgccgcagcccaagcccgccgacgggaacagggcg
ctgtacgggggcaagatcaaccgccgtatcaccgtccgggacatcaccgccgccaaggag
cgcggcgagaagtggcccatgctcaccgcgtacgacgcgatgaccgcctccgtcttcgac
gagtccggcatcccggtgatgctcgtcggcgactccgcgggcaactgccacctcggctac
gagaccaccgtgcccgtcacactggacgagatgacgatgctctcggccgcggtagtccgg
ggcaccagccgcgccctgatcgtgggcgacctgcccttcggctcctaccaggagggcccg
gtgcaggcgctgcgctcggcgactcggctggtcaaggaggccggggtcggcgcggtcaag
ctggagggcggcgagcgctcgcaccggcagatcgagctgctggtggagtccggcatcccg
gtgatggcgcacatcggcctcaccccgcagtccgtcaactccatgggctaccgggtgcag
ggccgcggcgaggaggcggcccagcagctgctgcgcgacgccaaggcggtccaggacgcg
ggcgccttcgcggtcgtcctggagctggtgccggccgagctggccgccgaggtgacccgg
acgctgcacatcccgacggtcggtatcggcgcgggcccggacaccgacgcccaggtgctg
gtgtggaccgacatgctcgggctgaccggcgggcggatgccgaagttcgtcaagcagtac
gccgacctgcgcaaggtcatgggcgacgcggcgaaggcgtacgccgaggacgtcgtcggc
ggcacgttccccgcggacgagcactccgtccactga

DBGET integrated database retrieval system