KEGG   Streptomyces coelicolor: SCO2346Help
Entry
SCO2346           CDS       T00085                                 

Gene name
SCC8A.04c
Definition
(RefSeq) hydrolase
  KO
K19270  
sugar-phosphatase [EC:3.1.3.23]
Organism
sco  Streptomyces coelicolor
Brite
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.23  sugar-phosphatase
     SCO2346 (SCC8A.04c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2515998..2516663)
Genome map
AA seq 221 aa AA seqDB search
MTATASTVLPARALLLDMDGTLVNSDAAVDRVWRRWADRHGLDGDEVMKVVHGRQGYASM
ALLLPDRPMEHNHADNARMLAEETADTEGVVAIPGAAEFLASLRGLPHALVTSADVALST
ARMAAAGLAQPDVRVTAESVGASKPDPEGFLKGAAELGIAPADCVVFEDSGAGIAAGRAA
GMRVVGVGPRAGFHGPDVVVEDLTRVRVEADADGGLRLHIG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaccgccagcaccgttctgcccgcccgcgccctgctgctcgacatggacggc
accctcgtcaactcggacgccgccgtggaccgcgtctggcggcgctgggccgaccggcac
ggactggacggcgacgaggtcatgaaggtcgtccacggacggcagggctacgcctcgatg
gcgctgctgctgccggaccggcccatggagcacaaccacgccgacaacgcgcgcatgctc
gccgaggagaccgccgacaccgagggcgtcgtcgcgatccccggcgccgcggagttcctc
gcctcgctgcgcgggctgccgcacgccctggtgacctcggccgacgtggccctgtccacc
gcgcggatggccgccgccgggctcgcgcagccggacgtccgggtcaccgccgagtcggtc
ggcgcgagcaagcccgacccggagggcttcctcaagggcgccgccgaactgggcatcgcc
cccgccgactgcgtcgtcttcgaggactccggcgccggcatcgcggccgggcgcgccgcc
gggatgcgggtcgtcggggtaggaccgcgcgccgggttccacgggccggacgtggtcgtg
gaggacctgacgcgggtgcgtgtcgaggcagacgcggacggcgggctgcgcctgcacatc
ggctga

DBGET integrated database retrieval system