KEGG   Streptomyces coelicolor: SCO2387Help
Entry
SCO2387           CDS       T00085                                 

Gene name
fabD, SC4A7.15
Definition
(RefSeq) ACP S-malonyltransferase
  KO
K00645  
[acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid biosynthesis
Prodigiosin biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sco00001]
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SCO2387 (fabD)
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    SCO2387 (fabD)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     SCO2387 (fabD)
Lipid biosynthesis proteins [BR:sco01004]
 Fatty acid synthase
  Component type
   SCO2387 (fabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Structure
PDB: 

Jmol
Position
2559340..2560290
Genome map
AA seq 316 aa AA seqDB search
MLVLVAPGQGAQTPGFLTDWLALPGAADRVAAWSDAIGLDLAHFGTKADADEIRDTSVAQ
PLLVAAGILSAAALGTQTSVADATGPGFTPGAVAGHSVGEITAAVFAGVLDDTAALSLVR
RRGLAMAEAAAVTETGMSALLGGDPEVSVAHLERLGLTPANVNGAGQIVAAGTMEQLAAL
NEDKPEGVRKVVPLKVAGAFHTRHMAPAVDKLAEAAKALTPADPKVTYVSNKDGRAVASG
TEVLDRLVGQVANPVRWDLCMETFKELGVTAIIEVCPGGTLTGLAKRALPGVKTLALKTP
DDLDAARELVAEHTQA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgtactcgtcgctcccggccagggcgcccagacgcccggcttcctgactgactgg
ctcgccctccccggtgccgctgaccgcgtcgccgcgtggtcggacgccatcggactcgat
ctcgcccacttcggcaccaaggccgacgcggacgagatccgagacacgtccgtggcccag
ccgctgctggtcgccgccggaatcctgtccgccgcggcactcggtacgcagacatctgtc
gctgacgcgacgggccccgggttcacccccggcgcggtcgccggacacagcgtcggcgag
atcaccgccgccgtcttcgcgggcgtcctcgacgacaccgccgcgctgtccctcgtacgc
cgtcgcggcctggccatggccgaggccgcggcggtcaccgagaccggcatgtcggcgctg
ctcgggggcgaccccgaggtgagcgtcgcgcacctggagcggctcggcctgaccccggcg
aacgtgaacggcgccggtcagatcgtggcggcgggcaccatggagcagctggccgcgctg
aacgaggacaagcccgagggtgtgcgcaaggtcgtcccgctgaaggtggccggcgcgttc
cacacccgccacatggcccccgccgtggacaagctcgccgaggccgccaaggcgctgacg
ccggccgacccgaaggtgacgtacgtctccaacaaggacgggcgggccgtcgcctccggc
accgaggtgctggaccggctggtcggccaggtcgccaacccggtgcgctgggacctgtgc
atggagacgttcaaggagctgggcgtcaccgcgatcatcgaggtgtgtccgggcggcacg
ctgaccgggctggccaagcgggcgctgcccggagtgaagacgctggccctgaagaccccc
gacgacctcgacgcggcccgtgagctcgtcgccgagcacacccaggcctga

DBGET integrated database retrieval system