KEGG   Streptomyces coelicolor: SCO2407Help
Entry
SCO2407           CDS       T00085                                 

Gene name
SC4A7.35
Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00052  Galactose metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
Module
sco_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO2407 (SC4A7.35)
   00052 Galactose metabolism
    SCO2407 (SC4A7.35)
Enzymes [BR:sco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SCO2407 (SC4A7.35)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 1097841
NCBI-ProteinID: NP_626653
Kitasato: SCO2407
UniProt: Q9RDN0
Position
2579862..2580962
Genome map
AA seq 366 aa AA seqDB search
MAATAVGGTAHASGGRKPVKELFGRLADGTKVYRWSLENGGTRMKVLSYGGVVESLEIPD
RRGRYANVSLGFDNLDDYVARSPHFGALIGRYGNRIAKGRFTLDGKEYQLSVNDGENSLH
GGALGFDYRVWDVEPFTHGSDTGLVLHYTSVDGEMGYPGTLRAKVTYTLTRRGDWRIDYE
ATTDKATVVNLTSHVYWNLAGEGSGTIEDHELSIAASRFTPTDAGLIPTGELARVSGTPF
DFRRAKPIGRDIRDAHPQLVTAKGFDHNWVLDKGITDRPEHIATLRENASGRTLRIATDQ
PGLQFYSGNFLDGTLTGTGGSLYRQGDALCLETQHFPDSPNQPSFPSTVLRPGETYRTST
VHSFDA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccaccgcggtcggcggcacggcgcacgcctcgggaggcaggaaacccgtgaag
gaactcttcggcaggctcgccgacgggacgaaggtgtaccgctggtcgctggagaacggc
ggcacgcggatgaaggtgctgtcgtacggcggcgtcgtggagtccctggagatcccggac
cgccggggccgctacgccaacgtctcgctgggcttcgacaacctcgacgactacgtcgcc
cgcagcccgcacttcggcgccctgatcgggcggtacggcaaccgcatcgccaagggccgt
ttcaccctggacggcaaggagtaccagctctccgtcaacgacggggagaactccctgcac
ggcggcgccctcggcttcgactaccgggtctgggacgtcgagcccttcacccacggctcg
gacaccggcctggtgctccactacaccagcgtcgacggcgagatgggctacccgggcacg
ctcagggcgaaggtgacgtacaccctcacccggcgcggcgactggcgcatcgactacgag
gccaccaccgacaaggccaccgtcgtcaacctcaccagccacgtctactggaacctggcc
ggcgagggcagcggcacgatcgaggaccacgagctgtcgatcgccgcctcccgcttcacc
cccaccgacgcgggcctgatccccaccggagaactggcccgggtgtccggcacgcccttc
gacttccgccgggccaagccgatcggccgggacatccgggacgcccacccgcagctggtc
accgccaagggcttcgaccacaactgggtgctcgacaagggcatcaccgaccgccccgag
cacatcgccaccctgcgcgagaacgcctccggccgcaccctgcgcatcgccaccgaccag
cccggactccagttctactcgggcaacttcctcgacggcaccctgaccggcaccggcggc
tccctctaccgccagggcgacgccctgtgcctggagacgcagcacttcccggactcgccg
aaccagccgtcgttcccgtcgaccgtgctgcggcccggcgagacctaccggacgtcgacg
gtgcactccttcgacgcctag

DBGET integrated database retrieval system