KEGG   Streptomyces coelicolor: SCO2445Help
Entry
SCO2445           CDS       T00085                                 

Gene name
SCC24.16
Definition
(RefSeq) acetyl CoA carboxylase subunits alpha/beta
  KO
K01962  
acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2]
K01963  
acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO2445 (SCC24.16)
   01212 Fatty acid metabolism
    SCO2445 (SCC24.16)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO2445 (SCC24.16)
   00640 Propanoate metabolism
    SCO2445 (SCC24.16)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SCO2445 (SCC24.16)
Enzymes [BR:sco01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SCO2445 (SCC24.16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
2624026..2625402
Genome map
AA seq 458 aa AA seqDB search
MTERLTAREFLALVTDDATFSELPHADGPWRPDGPLGWPGYDASRARAAERTGEAESVVC
GTGLVEGTRAVLVSFEFGFLGGSLGHRTGDRLEAAYAYAREHRLPVVPLVATGGSRMQEG
MLALTQLQRVARQSALTRAAGLAQIAVVRDPATGGGWATLGAGADVVLALPGAQVGFAGS
RVRPPDADPAAYTAEAQVAAGSADAVVPPGELRATLGRWLRLLTAPSGGPAPVPEPLGAR
DLPAGGWEAVRRARDPGRPRAGAYLDAYFTDRVALSGDRCGGRDPEGMLCGFGSHAGRTV
AYAAQTGTATRPAGYRTATRLIHLADRLGIPVLTLVDTPGAANDAEAERAGAGPAIADLF
GAVASARTPVTTLVIGEGGSGGALALAAPGSTWATPDSYFSVIAPEHAAAILKRPPAEVE
ATAGQLRLRPQDLAALGVIRTSEQLFPGTGDRRSEERM
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagcgcctgaccgcgcgggagttcctcgccctggtcaccgacgacgccaccttc
agcgaactcccgcacgcggacggcccgtggcggcccgacggccccctcggctggcccggc
tacgacgcctcgcgggctcgcgccgccgagcgcaccggcgaggcggagtccgtcgtctgc
ggcaccggcctggtggagggcacccgggcggtgctcgtctccttcgagttcggcttcctc
ggcggctcgctggggcaccgcaccggcgaccgtctggaggcggcgtacgcgtacgcccgt
gaacaccggctgccggtggtgccgttggtggcgaccggcggcagccggatgcaggagggg
atgctcgcgctgacccagctccagcgggtggcccggcagtcggcgctcacccgcgcggcc
ggcctcgcgcagatcgcggtggtacgggacccggcgaccggcggcggctgggcgacgctg
ggcgcgggcgccgacgtggtcctcgccctgcccggcgcccaggtgggcttcgccggttcg
cgggtccggccgccggacgcggacccggcggcgtacacggccgaggcgcaggtggcggcg
ggcagcgcggacgccgtcgtaccgcccggggagctgcgcgcgacgctggggcggtggctg
cggctgctgacggcgccgtccggcggtccggcgccggtgccggagccgctgggcgcccgg
gacctgccggccggcggctgggaggcggtgcgccgggcccgcgatcccggacgcccgcgc
gccggggcgtacctggacgcctacttcaccgaccgcgtcgccctgtccggcgaccgctgc
ggcggccgggacccggagggcatgctgtgcggcttcggctcgcacgcggggcgcacggtg
gcgtacgccgcgcagacgggcacggcgacccggcccgccgggtaccgcaccgccacccgg
ctgatccacctcgcggaccggctcggcatcccggtgctgaccctggtggacacaccgggc
gcggccaacgacgcggaggcggagcgggcgggggcgggtccggcgatcgcggacctgttc
ggcgccgtggcctcggcgcgtacgccggtcaccacgctggtgatcggcgagggcggctcg
ggcggggcgctggccctggccgcgcccggcagcacgtgggccaccccggacagctacttc
tccgtcatcgcgccggagcacgcggcggcgatcctgaagcgcccgccggcggaggtggag
gcgacggccggtcaactgcggctgcggccgcaggacttggcagcacttggcgtgatccga
acaagcgagcagttgttccctggaacaggtgatcgtcgctctgaagaacgcatgtga

DBGET integrated database retrieval system