KEGG   Streptomyces coelicolor: SCO2455Help
Entry
SCO2455           CDS       T00085                                 

Gene name
SCC24.26c
Definition
(RefSeq) spermidine synthase
  KO
K00797  
spermidine synthase [EC:2.5.1.16]
Organism
sco  Streptomyces coelicolor
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
beta-Alanine metabolism
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO2455 (SCC24.26c)
   00330 Arginine and proline metabolism
    SCO2455 (SCC24.26c)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO2455 (SCC24.26c)
   00480 Glutathione metabolism
    SCO2455 (SCC24.26c)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     SCO2455 (SCC24.26c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2642344..2643939)
Genome map
AA seq 531 aa AA seqDB search
MSSALDDRAVAAPPNPPADHHTRGARFLLLLAVFLCAACGLVYELALTALGSYLIGNSVL
QTSVVISVMVFAMGVGSLAAKPLRHRPVVAFAVVEGVLALVGGLSVLMLYAAFAWLQLYM
PAMIVVSLVVGLLIGAEIPLLMTLLQRIRTQEASSAVADMFAVDYIGALVGGLCFPLFLL
PTFGQLKGALVVGVVNAVAGVIVVVFIFRRQTGRLVKAGLLAGVALVLAALGTTYVLADD
LEVTARQHMYADPIIHSETTQYQDIVVTRSTAFTGEPDVRLFLNGDLQFSSVDEYRYHES
LVHPALSGPHSNVLIMGGGDGLALREVLRHEGVRHVTLVELDPAMTRLARTFEPLRKLNQ
GSLDDPRAKVVNADAFTWLREARQQYDAVIIDFPDPDSASLAKLYSVEFYDLLRRVLAPD
GQVMVQSGSPFFAPKTYWSIAKTIETAGYATTEFQIDVPSFGNWGFVLARPGTEAPPLRL
ARDTPKLRYLDAAVLKAATVFPVDRRRTDVRPSTLMDPAVLEYVQDEWRDY
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgagttccgccctggacgaccgtgccgtcgcggcgcccccgaaccccccggccgaccac
cacacccggggggcgcggttcctgctgctgctcgccgtcttcctctgcgcggcctgcggc
ctcgtgtacgaactggccctgaccgcgctgggcagctacctcatcggcaactcggtgctg
cagacctccgtggtcatctccgtgatggtcttcgccatgggcgtgggctcgctggccgcc
aaacccctgcgccaccgccccgtcgtcgccttcgcggtggtggagggagtactcgcgctg
gtcggcggtctgtccgtcctgatgctgtacgcggccttcgcctggctccagctctacatg
cccgcgatgatcgtggtgtccctggtggtgggcctgctcatcggcgccgagatcccgctg
ctgatgacgctgctccagcgcatccgcacgcaggaggcgagcagcgccgtcgccgacatg
ttcgccgtcgactacatcggcgccctcgtcggcggcctgtgcttcccgctgttcctgctg
ccgaccttcggccagttgaagggcgcgctggtggtcggcgtggtcaacgcggtcgccggg
gtcatcgtcgtggtgttcatcttccgccgccagaccggccggctggtcaaggccgggctg
ctggccggcgtcgccctggtgctcgccgcgctcggtacgacgtatgtgctggcggacgac
ctggaggtgacggcgcgccagcacatgtacgcggacccgatcatccactccgagacgacg
cagtaccaggacatcgtggtcacccgctccaccgccttcaccggcgagcccgacgtacgg
ctcttcctcaacggcgacctccagttcagctcggtcgacgagtaccgctaccacgagtcg
ctggtccaccccgcgctgtccggcccccactccaacgtgctgatcatgggcggcggtgac
gggctcgcgctgcgcgaggtgctgcgccacgagggcgtccggcacgtcaccctggtcgaa
ctggacccggcgatgacccggttggcgcgcaccttcgagccgctgcgaaagctcaaccag
ggttcgctggacgatccgcgggccaaggtcgtcaacgcggacgccttcacctggctgcgc
gaggcacggcagcagtacgacgcggtgatcatcgacttcccggacccggactcggcgtcg
ctggcgaagctgtactcggtggagttctacgatctgctccgccgggtgctggcgccggac
ggccaggtcatggtgcagagcggatcgccgttcttcgcccccaagacctactggtcgatc
gcgaagaccatcgagacggccgggtacgcgacgacggagttccagatcgacgtgccgagc
ttcggcaactggggcttcgtcctcgcccgccccggaaccgaggccccgccgctgcggctc
gcccgggacacgccgaagctgcgctacctggacgcggcggtcctgaaggcggccaccgtg
ttccccgtcgaccgccgccgcaccgacgtacggccgagcaccctgatggatcccgcggtg
ctcgaatacgttcaggacgagtggcgcgactactga

DBGET integrated database retrieval system