KEGG   Streptomyces coelicolor: SCO2470Help
Entry
SCO2470           CDS       T00085                                 

Gene name
SC7A8.09c
Definition
(RefSeq) deoxyguanosinetriphosphate triphosphohydrolase-like protein
  KO
K01129  
dGTPase [EC:3.1.5.1]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO2470 (SC7A8.09c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.5  Triphosphoric-monoester hydrolases
    3.1.5.1  dGTPase
     SCO2470 (SC7A8.09c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2659480..2660754)
Genome map
AA seq 424 aa AA seqDB search
MEGTAPPTPYDPASVARYAPEPDKRPGRTAFQRDRARILHSGALRRLAGKTQVVAPGEGS
PVWDASPRTRLTHSLECAQVGRELGAALGCDPDLVEAACLAHDLGHPPFGHNGEQALNAF
AEDCGGFEGNAQSLRLLTRIEPKRFTEDGSVGLNLTRATLDAATKYPWPRGAHPAVPASP
KFGVYDDDRPVFAWLREDAPGARTCFEAQVMDWADDVAYSVHDVEDGLHAGHIDPNCLLA
DPEREAVFDAAVGRFVPAGTDHAELAAALDRLLAQDWWPHGYDGSAPAQARLKDATSQLI
GRFCLAAEAATRAAYGDGRLTRYAAELVVPRETRMECAVLKAVAVRYVMQRTEQERLRAD
QRIVVAELAEALTARAPDGLDPQFRALFDAAADDRARKRVVVDQIASLTDASARSLHARL
TGHP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcaccgcaccccccaccccgtacgaccccgcgtccgtggcccgctacgccccc
gaacccgacaaacgccccggccgcaccgccttccagcgcgaccgcgcccgcatcctgcac
tccggcgccctgcgccgcctggccgggaagacgcaggtcgtcgcgccgggggagggcagc
cccgtctgggacgccagcccccgtacccgcctcacgcactccctggagtgcgcccaggtc
ggccgggagctgggcgccgccctcgggtgcgacccggacctcgtcgaggcggcctgcctc
gcgcacgacctgggccacccgcccttcgggcacaacggggaacaggcgctcaacgccttc
gccgaggactgcggcggcttcgagggcaacgcccagtcgctccggctcctcacccgcatc
gagcccaaacggttcaccgaggacggctccgtcgggctcaacctcacccgcgccacgctc
gacgccgccaccaagtacccgtggccccgcggtgcccaccccgccgttcccgcctcgccc
aagttcggggtgtacgacgacgaccggcccgtcttcgcgtggctccgcgaggacgccccc
ggcgcccgcacctgcttcgaggcccaggtgatggactgggccgacgacgtggcgtactcc
gtgcacgacgtcgaggacggcctgcacgccggccacatcgacccgaactgcctgctcgcc
gaccccgagcgcgaggcggtgttcgacgccgccgtcggacggttcgtgcccgccggcacc
gaccacgccgaactcgccgccgccctcgaccgcctcctcgcccaggactggtggccgcac
ggatacgacggctcggcgcccgcccaggcgcggctgaaggacgccaccagtcagctcatc
ggccgcttctgcctggccgccgaggccgccacccgggccgcgtacggcgacggccggctc
acccgctacgccgccgagctggtcgtgccccgcgagacccggatggagtgcgccgtcctc
aaggcggtcgccgtccgctacgtcatgcagcgcaccgagcaggagcggctccgcgccgac
cagcgcatcgtcgtcgccgagctggccgaggcgctcaccgcccgcgcgccggacgggctc
gacccccagttccgcgccctgttcgacgcggccgccgacgaccgcgcccgcaaacgggtg
gtcgtcgaccagatcgcctccctcaccgacgcctcggcccgctcgcttcacgcccgcctg
acggggcatccatga

DBGET integrated database retrieval system