KEGG   Streptomyces coelicolor: SCO2473Help
Entry
SCO2473           CDS       T00085                                 

Gene name
SC7A8.12
Definition
(RefSeq) nitrate reductase
  KO
K00372  
assimilatory nitrate reductase catalytic subunit [EC:1.7.99.4]
Organism
sco  Streptomyces coelicolor
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SCO2473 (SC7A8.12)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.4  nitrate reductase
     SCO2473 (SC7A8.12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
2662608..2665067
Genome map
AA seq 819 aa AA seqDB search
MQNTGTRTPATTPTHCPYCALQCGMNLTPVEGGTVEVSERTDFPVNRGALCGKGRTAAAV
LAPGARLTSPLVRSGDGALVPAGWDEALDRIAGNLERTRARYGADALGVFGGGGLTNEKA
YALGKFARVVLGTSQIDYNGRFCMSSAAAAGTRAFGLDRGLPFPLEDVPRTGCVILVGSN
PAETMPPSLRYFTELRENGGTLIVVDPRRTKTAEQADLHLAPRPGTDLALALGMLHLVVA
EGRVDEAYVEERTSGWEEARAAAMAHWPEYVERITGVSVPELREAVRLFCAPEAAMVLTA
RGPEQQAKGTDTVGAWINLCLATGRAGRPLSGYGCLTGQGNGQGGREHGQKADQLPGYRK
LTDPAARRHVAEVWGVDPDALPGPGRSAYELLDALGTDVRSLLVMGSNPVVSAPRAAHVE
GRLRSLDFLAVCDVVLSETAELADVVLPVTQWAEETGTTTSLEGRVLLRRRAITPPDGVR
GDLEVLHGLAGRLGVQKGFPTDPEEVFEELRRASAGGPADYSGIDYRRLAEENGVFWPCP
AQPAADDTHTADPGTGTDTRTRTGTGSGSGSGSGRDMSTETGTGSGMYTDTGTASGMSTD
TGSGSTDAGIGRDPRAATGTGSGMSTDTGRVTRTATGTGSGMSTDTGSDSDSDSSDAGAG
LRAAPHPGTPRLFLDRFATDDGRARFAPVTHRPSAEEPDDEYPVLLTTGRVVSQYQSGAQ
TRRVAELNAAAPGPFVELHPRLAARLGAADGDPLAVVSRRGRAVAPARITTGIRPDTVFM
PFHWPGEGRANTLTNPALDPTSRMPEFKVCAVRVETVTS
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacaccggcacgcgcacccccgccaccacccccacgcactgcccgtactgcgcc
ctgcagtgcgggatgaatctgacgcccgtcgagggcgggaccgtcgaggtgtccgagcgg
acggacttcccggtgaaccggggcgcgctgtgcggcaaggggcgtacggcggcggcggtg
ctggcgccgggagcgcggctgacctcgccgctggtgcggtcgggcgacggcgcgctggtg
ccggccggctgggacgaggcgctggaccggatcgccgggaacctggagcgcacacgggcg
cggtacggcgcggacgcgctcggggtgttcggcgggggcgggctgaccaacgagaaggcg
tacgcgctgggcaagttcgcccgggtggtgctgggcacctcgcagatcgactacaacggg
cggttctgcatgtcgtcggccgcggcggccgggacgcgggccttcgggctcgaccggggg
ctgccgttcccgctggaggacgtcccgcggaccgggtgcgtgatcctcgtggggtcgaac
ccggcggagacgatgccgccctcgctgcgctacttcaccgaactgcgggagaacggcggc
accctgatcgtcgtcgacccgcgccggacgaagaccgccgaacaggccgacctgcacctc
gcgcccaggcccggcaccgacctcgccctcgcgctcggcatgctgcacctggtggtcgcc
gagggccgggtcgacgaggcgtacgtcgaggagcgcacgtccggctgggaggaggcgcgg
gcggcggcgatggcgcactggccggagtacgtggagcggatcaccggggtgtccgtcccc
gaactgcgggaggcggtaaggctgttctgcgcgcccgaggcggcgatggtgctcaccgcg
cgcgggcccgagcagcaggccaagggcacggacacggtgggcgcgtggatcaacctgtgc
ctggcgaccgggcgggccgggcggccgctgtccgggtacggctgtctgaccgggcagggc
aacgggcagggcgggcgcgaacacggccagaaggcggaccagttgccgggctaccgcaag
ctgaccgacccagctgcgcggcggcacgtggccgaggtgtggggcgtggaccccgacgcg
ctgccggggccggggcgcagcgcgtacgagctgctggacgcgctggggacggacgtcagg
tcgctgctggtgatggggtccaacccggtcgtgtccgcgccccgggccgcgcacgtcgag
gggcggctgcggtcgctggacttcctggcggtgtgcgacgtggtgctctccgagacggcg
gaactggcggacgtcgtcctgccggtgacccagtgggcggaggagacggggaccacgacg
agtctggagggacgggtgctgctgcggcggcgcgcgatcacgccgccggacggggtgcgc
ggcgatctggaggtgctgcacgggctggccgggcggctcggcgtgcagaaggggttcccg
accgatcccgaggaggtcttcgaggagctgcggcgggcgagcgcgggcggcccggcggac
tactccgggatcgactaccggcggctggcggaggagaacggcgtcttctggccgtgcccg
gcgcaacccgcggccgacgacacacacaccgccgaccccggcaccggcacggacacccgc
acccgcaccggcacgggcagcggcagcggcagcggcagcggcagggacatgagcaccgag
acaggcaccggcagcggtatgtacaccgacacgggcaccgccagcggcatgagcacggac
accggcagcggcagcaccgacgccggcattggcagggacccccgcgccgccacgggcacc
ggcagcggcatgagcaccgacaccggcagggtcacccgcaccgccacgggcaccggcagc
ggcatgagcaccgacaccggcagcgacagcgacagcgacagcagcgacgccggcgccggg
ctccgcgccgcgccccaccccggcaccccgcgcctcttcctcgaccggttcgccaccgac
gacggccgggcccggttcgcgcccgtgacgcaccggccgagcgcagaggagccggacgac
gagtaccccgtgctgctgaccaccgggcgggtcgtgtcgcagtaccagtccggggcgcag
acccggcgggtggccgagctgaacgccgccgcgccgggcccgttcgtggagctgcacccg
cggctcgcggcacggctgggggcggccgacggcgacccgctggcggtggtgtcccggcga
gggcgggcggtggcaccggcccgcatcaccaccggcatccggcccgacacggtgttcatg
ccgttccactggccgggcgagggccgcgccaacaccctgaccaacccggccctggacccg
acttcgcggatgccggagttcaaggtgtgtgcggtgcgggtggaaacggtgacgtcctag

DBGET integrated database retrieval system