KEGG   Streptomyces coelicolor: SCO2528Help
Entry
SCO2528           CDS       T00085                                 

Gene name
leuA, SCC121.31c
Definition
(RefSeq) 2-isopropylmalate synthase
  KO
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO2528 (leuA)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO2528 (leuA)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     SCO2528 (leuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2725480..2727201)
Genome map
AA seq 573 aa AA seqDB search
MANRQQPSPMPTAKYRGYDQVDIADRTWPNQRITTAPRWLSTDLRDGNQALIDPMSPVRK
RAMFDLLVKMGYKEIEVGFPASGQTDFDFVRSIIEEPGAIPDDVTISVLTQAREDLIERT
VESLKGARRATVHLYNATAPVFRRVVFRGSRDDIKQIAVDGTRLVMEYAEKLLGPETEFG
YQYSPEIFTDTELDFALEVCEAVMDTYQPGPGREIILNLPATVERSTPSTHADRFEWMGR
NLSRREHVCLSVHPHNDRGTAVAAAELALMAGADRIEGCLFGQGERTGNVDLVTLGMNLF
SQGVDPQIDFSDIDEIRRTWEYCNQMEVHPRHPYVGDLVYTSFSGSHQDAIKKGFDAMEA
DAAARGVTVDDIEWAVPYLPIDPKDVGRSYEAVIRVNSQSGKGGIAYVLKNDHSLDLPRR
MQIEFSKLIQAKTDAEGGEITPTAIWDVFQDEYLPNPDNPWGRIQVANGQTTTDRDGVDT
LTVDATVDGAETTLVGSGNGPISAFFHALQGVGIDVRLLDYQEHTMSEGASAQAASYIEC
AIGDKVLWGIGIDANTTRASLKAVVSAVNRATR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggccaaccgccagcagcccagccccatgccgaccgccaagtaccgcggctacgaccag
gtcgacatcgccgaccgcacctggccgaaccagcggatcaccaccgctccccgctggctc
tccaccgacctgcgcgacggcaaccaggccctgatcgaccccatgtcgccggtccgcaag
cgcgccatgttcgacctgctggtcaagatgggctacaaggagatcgaggtcggcttcccg
gcctccggccagaccgacttcgacttcgtgcgctccatcatcgaggagcccggcgccatc
ccggacgacgtcaccatctccgtactgacccaggcccgcgaggacctgatcgagcgcacg
gtggagtccctgaagggcgcccggcgggccaccgtccacctgtacaacgccaccgccccg
gtcttccgccgggtcgtcttccgcggctcgcgcgacgacatcaagcagatcgcggtcgac
ggcacccgcctggtcatggagtacgccgagaagctgctgggcccggagacggagttcggc
taccagtactcgccggagatcttcaccgacaccgagctggacttcgccctggaggtctgc
gaggcggtgatggacacctaccagcccggccccggccgcgagatcatcctcaacctgccc
gccacggtggagcgttccacgccgtccacgcacgccgaccgcttcgagtggatgggccgc
aacctgtcccgccgcgagcacgtctgcctgtccgtccacccgcacaacgaccgcggtacg
gcggtggcggcggccgagctggcgctgatggccggcgccgaccgcatcgagggctgcctg
ttcggacagggcgagcgcaccggcaacgtcgacctggtcaccctgggcatgaacctgttc
tcccagggcgtcgacccgcagatcgacttctccgacatcgacgagatccgtcgcacgtgg
gagtactgcaaccagatggaggtccacccgcgccacccgtacgtgggcgacctggtctac
acgtccttctccggctcccaccaggacgccatcaagaagggcttcgacgccatggaggcc
gacgcggccgccaggggcgtcaccgtcgacgacatcgagtgggccgtcccgtacctgccc
atcgaccccaaggacgtcggccgctcctacgaggccgtcatccgcgtcaactcgcagtcc
ggcaagggcggcatcgcgtacgtcctgaagaacgaccacagcctggacctgccgcgccgg
atgcagatcgagttctcgaagctcatccaggccaagaccgacgccgagggcggcgagatc
acgccgaccgcgatctgggacgtcttccaggacgagtacctgcccaacccggacaacccc
tggggccgcatccaggtggccaacgggcagaccacgaccgaccgcgacggcgtcgacacc
ctcaccgtggacgccacggtcgacggtgcggagaccaccctggtcggcagcggcaacggc
ccgatctcggcgttcttccacgcactgcagggcgtcggcatcgacgtacggctgctggac
taccaggagcacacgatgagcgagggcgcctccgcgcaggccgcctcctacatcgagtgc
gcgatcggcgacaaggtgctgtggggcatcggaatcgacgcgaacaccacgcgcgcctcg
ctgaaggccgtcgtctccgccgtcaaccgcgcgactcgctga

DBGET integrated database retrieval system