KEGG   Streptomyces coelicolor: SCO2528Help
Entry
SCO2528           CDS       T00085                                 

Gene name
leuA, SCC121.31c
Definition
(RefSeq) 2-isopropylmalate synthase
  KO
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO2528 (leuA)
   01230 Biosynthesis of amino acids
    SCO2528 (leuA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO2528 (leuA)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO2528 (leuA)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     SCO2528 (leuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2725480..2727201)
Genome map
AA seq 573 aa AA seqDB search
MANRQQPSPMPTAKYRGYDQVDIADRTWPNQRITTAPRWLSTDLRDGNQALIDPMSPVRK
RAMFDLLVKMGYKEIEVGFPASGQTDFDFVRSIIEEPGAIPDDVTISVLTQAREDLIERT
VESLKGARRATVHLYNATAPVFRRVVFRGSRDDIKQIAVDGTRLVMEYAEKLLGPETEFG
YQYSPEIFTDTELDFALEVCEAVMDTYQPGPGREIILNLPATVERSTPSTHADRFEWMGR
NLSRREHVCLSVHPHNDRGTAVAAAELALMAGADRIEGCLFGQGERTGNVDLVTLGMNLF
SQGVDPQIDFSDIDEIRRTWEYCNQMEVHPRHPYVGDLVYTSFSGSHQDAIKKGFDAMEA
DAAARGVTVDDIEWAVPYLPIDPKDVGRSYEAVIRVNSQSGKGGIAYVLKNDHSLDLPRR
MQIEFSKLIQAKTDAEGGEITPTAIWDVFQDEYLPNPDNPWGRIQVANGQTTTDRDGVDT
LTVDATVDGAETTLVGSGNGPISAFFHALQGVGIDVRLLDYQEHTMSEGASAQAASYIEC
AIGDKVLWGIGIDANTTRASLKAVVSAVNRATR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggccaaccgccagcagcccagccccatgccgaccgccaagtaccgcggctacgaccag
gtcgacatcgccgaccgcacctggccgaaccagcggatcaccaccgctccccgctggctc
tccaccgacctgcgcgacggcaaccaggccctgatcgaccccatgtcgccggtccgcaag
cgcgccatgttcgacctgctggtcaagatgggctacaaggagatcgaggtcggcttcccg
gcctccggccagaccgacttcgacttcgtgcgctccatcatcgaggagcccggcgccatc
ccggacgacgtcaccatctccgtactgacccaggcccgcgaggacctgatcgagcgcacg
gtggagtccctgaagggcgcccggcgggccaccgtccacctgtacaacgccaccgccccg
gtcttccgccgggtcgtcttccgcggctcgcgcgacgacatcaagcagatcgcggtcgac
ggcacccgcctggtcatggagtacgccgagaagctgctgggcccggagacggagttcggc
taccagtactcgccggagatcttcaccgacaccgagctggacttcgccctggaggtctgc
gaggcggtgatggacacctaccagcccggccccggccgcgagatcatcctcaacctgccc
gccacggtggagcgttccacgccgtccacgcacgccgaccgcttcgagtggatgggccgc
aacctgtcccgccgcgagcacgtctgcctgtccgtccacccgcacaacgaccgcggtacg
gcggtggcggcggccgagctggcgctgatggccggcgccgaccgcatcgagggctgcctg
ttcggacagggcgagcgcaccggcaacgtcgacctggtcaccctgggcatgaacctgttc
tcccagggcgtcgacccgcagatcgacttctccgacatcgacgagatccgtcgcacgtgg
gagtactgcaaccagatggaggtccacccgcgccacccgtacgtgggcgacctggtctac
acgtccttctccggctcccaccaggacgccatcaagaagggcttcgacgccatggaggcc
gacgcggccgccaggggcgtcaccgtcgacgacatcgagtgggccgtcccgtacctgccc
atcgaccccaaggacgtcggccgctcctacgaggccgtcatccgcgtcaactcgcagtcc
ggcaagggcggcatcgcgtacgtcctgaagaacgaccacagcctggacctgccgcgccgg
atgcagatcgagttctcgaagctcatccaggccaagaccgacgccgagggcggcgagatc
acgccgaccgcgatctgggacgtcttccaggacgagtacctgcccaacccggacaacccc
tggggccgcatccaggtggccaacgggcagaccacgaccgaccgcgacggcgtcgacacc
ctcaccgtggacgccacggtcgacggtgcggagaccaccctggtcggcagcggcaacggc
ccgatctcggcgttcttccacgcactgcagggcgtcggcatcgacgtacggctgctggac
taccaggagcacacgatgagcgagggcgcctccgcgcaggccgcctcctacatcgagtgc
gcgatcggcgacaaggtgctgtggggcatcggaatcgacgcgaacaccacgcgcgcctcg
ctgaaggccgtcgtctccgccgtcaaccgcgcgactcgctga

DBGET integrated database retrieval system