KEGG   Streptomyces coelicolor: SCO2531Help
Entry
SCO2531           CDS       T00085                                 

Gene name
SCC117.04
Definition
(RefSeq) beta-glucosidase
  KO
K05350  
beta-glucosidase [EC:3.2.1.21]
Organism
sco  Streptomyces coelicolor
Pathway
Cyanoamino acid metabolism
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCO2531 (SCC117.04)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SCO2531 (SCC117.04)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     SCO2531 (SCC117.04)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
2728980..2730326
Genome map
AA seq 448 aa AA seqDB search
MATDDAMPAKPMPRFPDGFLWGVSTSAHQIEGAAGLRGPSVWDAFTAEPGRVRDGSTAAV
ACDHYHRYREDVALLAGLGVDAYRFSVSWPRVDSPGGLDFYDRLVDELCAAGVRPVPTLF
HWDLPAGLDWLERDTAARFAEYVSLVAERLGDRVGKWITLNEPAEHTLLGHALGVHAPGR
ELLFDALPVAHHQLLAHGLAVRALRAAGATDVGIANSHGPTWPASDDPADREAADFYDLL
LNRMFADPLLTGRYPEGVGALMPGSAERVEADLEVIAEPLDWYGVNYYAPTRVGAPQGAE
IEFGGVTLPAELPFSVRRIEGRPVTDFGWPVVPEGLTELLTGFRDRYGDRLPPVVITENG
CSYEGLDDHDRIAYLDGHVRALHRAIEAGVDVRGYFVWSLLDNFEWAEGYARRFGLVHVD
FTTLARTPKASYGWFRDLLDGQRRVPVG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgacgacgcgatgccggcgaagccgatgccgcggttcccggacggcttcctg
tggggcgtgtccacgtccgcgcaccagatcgagggtgcggccgggctgcgggggccgtcc
gtgtgggacgcgttcacggcggagcccggccgggtgagggacggctcgacggcggcggtg
gcctgcgaccactaccaccgctaccgcgaggacgtggcgctcctcgccggcctgggcgtg
gacgcctaccgcttctcggtctcctggccccgggtggactcccccggcggcctggacttc
tacgaccgcctggtggacgagctgtgcgcggcgggcgtgcggccggtgccgacgctgttc
cactgggacctgccggcgggcctggactggctggagcgggacacggccgcccggttcgcc
gagtacgtgtcactcgtcgcggagcgcctcggcgaccgggtcggcaagtggatcaccctc
aacgagcccgccgagcacaccctgctcggccacgccctgggcgtccacgcccccggccgg
gagctgctcttcgacgccctcccggtcgcccaccaccagctcctggcgcacggcctggcg
gtgcgggcgctgcgcgcggcgggcgcgacggacgtggggatcgccaactcgcacggtccg
acgtggcccgcctcggacgacccggcggaccgggaagcggcggacttctacgacctcctg
ctgaaccggatgttcgccgacccgctgctgaccgggcggtacccggagggcgtcggcgcg
ctcatgcccggttccgccgaacgggtcgaggccgacctggaggtcatcgccgagccgctg
gactggtacggcgtgaactactacgcgccgacccgggtgggcgccccgcagggcgcggag
atcgagttcggcggggtgacgctcccggccgaactgcccttctcggtgcgccggatcgag
gggcggccggtgacggacttcggctggcccgtggtcccggaggggctgacggagctgctc
accggtttccgggaccgctacggcgaccggctcccgccggtcgtgatcacggagaacggc
tgctcctacgagggcctcgacgaccatgaccgcatcgcctacctcgacgggcacgtgcgc
gccctgcaccgggcgatcgaggcgggcgtggacgtgcgcggctacttcgtgtggtcgctc
ctggacaacttcgagtgggccgaggggtacgcccgccgcttcggactggtccacgtggac
ttcacgacgctcgcgcgcacgcccaaggcgtcgtacggctggttccgggatctgctcgac
gggcagcggcgggtaccggtcggataa

DBGET integrated database retrieval system