KEGG   Streptomyces coelicolor: SCO2576Help
Entry
SCO2576           CDS       T00085                                 

Gene name
pgm2, SCC123.14c
Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO2576 (pgm2)
   01230 Biosynthesis of amino acids
    SCO2576 (pgm2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO2576 (pgm2)
  Energy metabolism
   00680 Methane metabolism
    SCO2576 (pgm2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO2576 (pgm2)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     SCO2576 (pgm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2782944..2783615)
Genome map
AA seq 223 aa AA seqDB search
MSATGEVTAGRPGRGRRVILWRHGQTAWNVERRFQGSTDVALTETGVNQARRAAGLLLHL
RPDAIVASDLARAADTAAELSVLTGLEVTLEEGLRETYAGVWQGLTHEEIITRYGDEYAA
WKRGEPVRRGGGELETEVADRAAPVVLRHAEKLPEDGTLVVVSHGGTIRTTIGRLLGLEP
HSWESLGGLTNCCWSVLGEGARGWRLLEHNAGTLPEPVIGDDV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaccggtgaggtgacggcgggcaggccgggccgcggccgccgcgtcatcctg
tggcggcacggccagaccgcgtggaacgtggagcgccgcttccagggcagcacggacgtc
gcgctgaccgagaccggcgtgaaccaggcccgccgcgcggccggactgctcctgcacctg
aggcccgacgcgatcgtcgcctccgacctcgcgcgcgccgcggacacggccgccgagctg
tccgtgctcaccggcctcgaggtgaccctggaggagggcctgcgggagacctacgcgggc
gtctggcaggggctgacccacgaggagatcatcaccaggtacggcgacgagtacgcggcc
tggaagcgcggcgagcccgtgcgccgcggcggcggcgagctggagaccgaggtcgccgac
cgcgccgcccccgtggtgctccggcacgccgagaagctccccgaggacggcaccctcgtc
gtggtcagccacggcggcacgatccgcaccaccatcggccgcctgctcggcctggaaccg
cacagctgggagagcctcggcggcctgaccaactgctgctggtccgtgctgggcgagggc
gcccgcggctggcgcctgctggagcacaacgccggcaccctgccggaaccggtgatcggc
gacgacgtctga

DBGET integrated database retrieval system