KEGG   Streptomyces coelicolor: SCO2576Help
Entry
SCO2576           CDS       T00085                                 

Gene name
pgm2, SCC123.14c
Definition
(RefSeq) phosphoglycerate mutase
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
sco  Streptomyces coelicolor
Brite
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     SCO2576 (pgm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 1098010
NCBI-ProteinID: NP_626814
Kitasato: SCO2576
UniProt: Q9RDL0
Position
complement(2782944..2783615)
Genome map
AA seq 223 aa AA seqDB search
MSATGEVTAGRPGRGRRVILWRHGQTAWNVERRFQGSTDVALTETGVNQARRAAGLLLHL
RPDAIVASDLARAADTAAELSVLTGLEVTLEEGLRETYAGVWQGLTHEEIITRYGDEYAA
WKRGEPVRRGGGELETEVADRAAPVVLRHAEKLPEDGTLVVVSHGGTIRTTIGRLLGLEP
HSWESLGGLTNCCWSVLGEGARGWRLLEHNAGTLPEPVIGDDV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaccggtgaggtgacggcgggcaggccgggccgcggccgccgcgtcatcctg
tggcggcacggccagaccgcgtggaacgtggagcgccgcttccagggcagcacggacgtc
gcgctgaccgagaccggcgtgaaccaggcccgccgcgcggccggactgctcctgcacctg
aggcccgacgcgatcgtcgcctccgacctcgcgcgcgccgcggacacggccgccgagctg
tccgtgctcaccggcctcgaggtgaccctggaggagggcctgcgggagacctacgcgggc
gtctggcaggggctgacccacgaggagatcatcaccaggtacggcgacgagtacgcggcc
tggaagcgcggcgagcccgtgcgccgcggcggcggcgagctggagaccgaggtcgccgac
cgcgccgcccccgtggtgctccggcacgccgagaagctccccgaggacggcaccctcgtc
gtggtcagccacggcggcacgatccgcaccaccatcggccgcctgctcggcctggaaccg
cacagctgggagagcctcggcggcctgaccaactgctgctggtccgtgctgggcgagggc
gcccgcggctggcgcctgctggagcacaacgccggcaccctgccggaaccggtgatcggc
gacgacgtctga

DBGET integrated database retrieval system