KEGG   Streptomyces coelicolor: SCO2579Help
Entry
SCO2579           CDS       T00085                                 

Gene name
nadD
Definition
(RefSeq) nicotinic acid mononucleotide adenylyltransferase
  KO
K00969  
nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]
Organism
sco  Streptomyces coelicolor
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCO2579 (nadD)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     SCO2579 (nadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(2785946..2786662)
Genome map
AA seq 238 aa AA seqDB search
MGEHDTPTGPAHAPARGTQNAVPARATGPVQGPVNGPADGPSAGKRRLGVMGGTFDPIHH
GHLVAASEVAAQFQLDEVVFVPTGQPWQKSHRAVSAAEDRYLMTVVATVENPQFSVSRID
IDRGGPTYTVDTLRDLRALNPDADLFFITGADALAQILTWRDSEELFSLAHFIGVTRPGH
TLTDAGLPKGGVSLVEVPALAISSTDCRARVAKGDPVWYLVPDGVVRYIDKRHLYRGE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgggagagcacgacacgcctaccggcccggcgcacgcgccggcgcgcggcacgcagaac
gcggtgcccgcccgcgccaccggtccggtccagggcccggtgaacggtccggccgacggc
ccgtcggccggcaagcgacgcctgggcgtcatgggcggcaccttcgacccgatccaccac
ggccacctcgtggccgccagcgaggtcgccgcgcagttccagctcgacgaggtggtgttc
gtgccgaccgggcagccgtggcagaagagccaccgcgcggtctccgcggccgaggaccgc
tatctgatgacggtcgtcgcgacggtcgagaacccgcagttctccgtcagccgcatcgac
atcgaccgcggcggccccacctacaccgtcgacaccctgcgcgacctgcgcgccctcaac
ccggacgcggacctgttcttcatcaccggggccgacgccctcgcccagatcctcacctgg
cgcgacagcgaggaactgttctccctcgcccacttcatcggtgtcacccggcccggccac
accctcacggacgccgggctccccaagggcggcgtctcgctcgtcgaggtccccgccctc
gccatctcctccacggactgccgtgcgagagtcgccaagggcgatcccgtctggtacctg
gtgcccgacggagtcgtgcgctatatcgacaaacgccacctgtaccgcggcgagtga

DBGET integrated database retrieval system