KEGG   Streptomyces coelicolor: SCO2612Help
Entry
SCO2612           CDS       T00085                                 

Gene name
ndk
Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  
nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:sco00001]
  Nucleotide metabolism
   00230 Purine metabolism
    SCO2612 (ndk)
   00240 Pyrimidine metabolism
    SCO2612 (ndk)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     SCO2612 (ndk)
Membrane trafficking [BR:sco04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    SCO2612 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2836247..2836660)
Genome map
AA seq 137 aa AA seqDB search
MTQRSLVLLKPDAVRRGLTGEIISRIERKAGWQITALELRTLDTETLEQHYGEHKGKPFY
EPLVEFMASGPVVAMVVEGERVIEGVRALAGPTDPIAAAPGSIRGDYGVIVRENLIHASD
SEESAERELKIFFPGRV
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagcgcagcctcgtcctcctcaagcccgacgccgtccgtcgtggcctgaccggc
gagatcatcagccgcatcgagcgcaaggccggctggcagatcaccgcgctggaactgcgc
accctggacaccgagacgctggagcagcactacggcgagcacaagggcaagcccttctac
gagccgctggtcgagttcatggcctccgggccggtcgtggcgatggtcgtcgagggcgag
cgggtcatcgagggcgtgcgcgcgctggccggtccgaccgacccgatcgccgccgccccg
ggctccatccgcggggactacggcgtgatcgtccgcgagaacctgatccacgcctccgac
tccgaggagtccgccgagcgcgagctgaagatcttcttcccgggccgggtctga

DBGET integrated database retrieval system