KEGG   Streptomyces coelicolor: SCO2627Help
Entry
SCO2627           CDS       T00085                                 

Gene name
SC8E4.02c
Definition
(RefSeq) ribose-5-phosphate isomerase B
  KO
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO2627 (SC8E4.02c)
   01230 Biosynthesis of amino acids
    SCO2627 (SC8E4.02c)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO2627 (SC8E4.02c)
   00051 Fructose and mannose metabolism
    SCO2627 (SC8E4.02c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     SCO2627 (SC8E4.02c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2854112..2854591)
Genome map
AA seq 159 aa AA seqDB search
MYLGSDHAGFELKNHLVEWLAAAGHEPVDCGPHIYDAQDDYPPFCLRAAERTAADQGALG
IVIGGSGNGEQIAANKVKGVRAALAWSEETASLGRQHNNANVVAVGARMHTQEEATKFVE
TFLGTPFSGDERHIRRIDMLTSYETTGDLPPVPSHHPQQ
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgtatctcggctcggaccatgcgggcttcgaactcaagaaccacctcgtcgagtggctc
gcggcggcgggacacgagcccgtcgactgcggtccgcacatctacgacgcccaggacgac
tacccgcccttctgcctgcgcgccgccgagcgcacggccgcggaccagggcgccctcggc
atcgtgatcggcggttccggcaacggcgagcagatcgcggcgaacaaggtgaagggcgtg
cgcgcggcgctggcctggagcgaggagacggcgtcgctgggccgccagcacaacaacgcc
aacgtcgtcgcggtcggcgcccgcatgcacacgcaggaggaggcgacgaagttcgtcgag
accttcctcggcaccccgttctccggcgacgaacgccacatccgccgcatcgacatgctc
acgtcctacgagacgacgggcgaccttcccccggtcccgtcccaccacccgcagcagtag

DBGET integrated database retrieval system