KEGG   Streptomyces coelicolor: SCO2640Help
Entry
SCO2640           CDS       T00085                                 

Gene name
asd1, SC8E4A.10
Definition
(RefSeq) aspartate-semialdehyde dehydrogenase
  KO
K00133  
aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Threonine biosynthesis, aspartate => homoserine => threonine
Ectoine biosynthesis, aspartate => ectoine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO2640 (asd1)
   01230 Biosynthesis of amino acids
    SCO2640 (asd1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO2640 (asd1)
   00270 Cysteine and methionine metabolism
    SCO2640 (asd1)
   00300 Lysine biosynthesis
    SCO2640 (asd1)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO2640 (asd1)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     SCO2640 (asd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
2870836..2871858
Genome map
AA seq 340 aa AA seqDB search
MRVGIVGATGQVGTVMRRILTERDFPVTELRLFASARSAGKELDGVTVEDAATADYSGLD
IVLFSAGGATSKALAEKVASQGPVVIDNSSAWRRDPEVPLVVSEVNPHAITDRPKGIIAN
PNCTTMAAMPVLRPLHAEAGLEAVVVATYQAVSGSGLAGVDELFEQVQKVGADAPKLTHD
GSAVEFPKPDKYVAPIAYNVLPLAGSIVDDGLHETDEEQKLRNESRKILEIPELKVSGTC
VRVPVFSGHSLQINARFARPISVERAKELLAGAPGVALTEVPTPLEAAGQDPSYVGRIRQ
DETVDNGLALFVSNDNLRKGAALNAVQIAELVAAELSAAK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgagggtcggaatcgtcggagccaccggtcaggtgggcacggtcatgcgcaggatcctc
acggagcgcgacttccccgtcaccgagctgcgcctgttcgcctcggcgcgcagcgccggc
aaggagctggacggcgtgacggtggaggacgcggccaccgccgactactccgggctggac
atcgtgctgttctcggcgggcggcgccacctccaaggcgctggccgaaaaggtcgcctcg
cagggccccgtcgtgatcgacaactcctccgcctggcgccgcgaccccgaggtcccgctg
gtggtctccgaggtgaacccgcacgcgatcaccgaccgccccaagggcatcatcgccaac
ccgaactgcaccacgatggccgcgatgccggtgctgcgcccgctgcacgcggaggcgggc
ctggaggcggtcgtcgtcgccacctaccaggcggtgtccggctccggcctggccggtgtg
gacgagctgttcgagcaggtccagaaggtcggcgcggacgcccccaagctgacccacgac
ggttcggcggtcgagttcccgaagccggacaagtacgtggcgcccatcgcgtacaacgtg
ctgccgctggccggttccatcgtcgacgacggcctgcacgagacggacgaggagcagaag
ctccgcaacgagtcccgcaagatcctggagatcccggagctgaaggtgtccggcacctgc
gtgcgcgtgcccgtcttcagcggccactccctgcagatcaacgcccgtttcgcccggccg
atcagcgtggagcgcgccaaggagctgctggccggagcccccggcgtggcgctcaccgag
gtgccgacgccgctggaggcggccggtcaggacccgtcgtacgtgggccggatccgccag
gacgagaccgtggacaacggcctcgccctgttcgtctccaacgacaacctccgcaagggc
gcggccctgaacgcggtgcagatcgcggagctggtcgcggccgagctgtccgccgccaag
tag

DBGET integrated database retrieval system