KEGG   Streptomyces coelicolor: SCO2688Help
Entry
SCO2688           CDS       T00085                                 

Gene name
ribD, SCC61A.09
Definition
(RefSeq) riboflavin-specific deaminase
  KO
K11752  
diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
sco  Streptomyces coelicolor
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Quorum sensing
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SCO2688 (ribD)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SCO2688 (ribD)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     SCO2688 (ribD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     SCO2688 (ribD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
2931848..2932993
Genome map
AA seq 381 aa AA seqDB search
MRRALELAGAEVGSTGSNPAVGCVLLDAEGTTVATGVHRGPGTPHAEVDALRRARGRHRG
TTAVVTLEPCDHQGRTGPCSKALIEAGVRRVLYAVADPNRVAAGGARRLADAGVEVVGGV
LGAEAEAVLEMWLTAVRAGRPFVTWKFAATLDGRSAAADGSARWISSAESRADAHELRAR
HDAVLVGSGTWRSDDPRLDLRHGVVGHPPLRIALDARGELPPDSRLLDGAAPTLVVTDPA
TGTADHGESESNNNSGINTSTNTSTSRGANSGPDVLRLKTDARGHFPPLDLLAALDGRGV
RSVLVEGGPALAASFVRAGLVDRVVAYVAPLLLGSEGVSATGPLGIGSIREAHRFRITSV
DRIGPDLRIELRPPARTGGTQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgggcgctggagctggccggggccgaggtggggtcgaccggctcgaatcccgcg
gtcggctgcgtgctgctcgacgcggagggcacaacggtcgcgaccggtgtccaccggggg
ccgggcaccccgcacgcggaggtcgacgcgctgcggcgggcgcgggggcggcaccgcggg
accaccgccgtggtcaccctcgaaccctgcgaccaccagggccgcaccgggccctgctcc
aaggccttgatcgaggccggggtccgccgcgtcctgtacgcggtggcggacccgaaccgg
gtcgcggccggcggcgcgagacggctggccgacgccggggtcgaggtcgtcggcggggtc
ctcggggccgaggccgaggccgtactggagatgtggctcaccgccgtacgcgccggacgg
cccttcgtcacctggaagttcgccgcgaccctggacggccgcagcgccgccgccgacggc
tccgcccgctggatcagctcggccgagtcccgggcggacgcccacgaactgcgcgcccgg
cacgacgcggtcctcgtcggctcgggcacctggaggtccgacgacccccggctcgacctg
cgtcacggcgtcgtggggcaccctcccctgcggatcgcgctggacgcccgcggtgagctg
ccgccggactcccggctgctggacggtgccgccccgacgctcgtggtgactgatccggcc
accggaacagccgaccacggcgagagcgaaagcaacaacaacagcggcatcaacaccagc
accaacaccagcaccagcaggggcgccaacagcggccccgacgtactgcgtctgaagacc
gacgcgcgcgggcacttcccgcccctcgacctgctcgccgcgctggacggccggggggtg
cggtccgtgctggtcgaagggggtcccgcactcgccgcctccttcgtccgcgccgggctc
gtcgaccgcgtcgtcgcctatgtcgcgcccctcctcctgggctccgagggagtcagcgcc
accggaccgctcggcatcgggtcgatccgcgaggcacaccggttccgcatcacctcggtg
gaccggatcggacccgacctgcggatcgaactgcggcctcccgccaggaccggagggaca
cagtga

DBGET integrated database retrieval system