KEGG   Streptomyces coelicolor: SCO2726Help
Entry
SCO2726           CDS       T00085                                 

Gene name
msdA, SCC46.11c
Definition
(RefSeq) methylmalonic acid semialdehyde dehydrogenase
  KO
K00140  
malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Inositol phosphate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO2726 (msdA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCO2726 (msdA)
   00562 Inositol phosphate metabolism
    SCO2726 (msdA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO2726 (msdA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO2726 (msdA)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     SCO2726 (msdA)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     SCO2726 (msdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2973144..2974646)
Genome map
AA seq 500 aa AA seqDB search
MTNIVNHWIGGKTAEGASGTYGPVTNPATGEVTTKVAFASVDEVDAAVAAAREAYLTWGQ
SSLAQRTSILFRFRALLDAHRDEIAELITAEHGKVHSDALGEVARGLEIVDLACGINVQL
KGELSTQVATRVDVSSIRQPLGVVAGITPFNFPAMVPLWMFPIAIACGNTFVLKPSEKDP
SAAVKVAELLSEAGLPDGVFNVVHGDKVAVDRLLEHPDVKAVSFVGSTPIARYIHTTASA
NGKRVQALGGAKNHMLVLPDADLDAAADAAVSAAYGSAGERCMAISAVVAVGAVGDELVE
KIRERAEKIKIGPGTDPSSEMGPLITKAHRDKVASYVAGAAAEGCEVVLDGTGYTVDGHE
DGHWIGISLLDRVPTTAKAYQDEIFGPVLCVLRADTYEEGVALINASPFGNGTAIFTRDG
GAARRFQLEIEAGMVGVNVPIPVPVGYHSFGGWKDSLFGDHHIYGNDGTHFYTRGKVVTT
RWPDPADAPAGVDLGFPRNH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacatcgtcaaccactggatcggcggcaagaccgccgaaggcgcctcgggcacg
tacgggccggtgacgaacccggcgaccggcgaggtcaccaccaaggtcgccttcgcctcc
gtcgacgaggtggacgccgcggtcgccgccgccagggaggcgtacctgacctgggggcag
tcctcgctggcgcagcggacctcgatcctcttccgcttccgggcgctgctggacgcgcac
cgcgacgagatcgccgagctgatcaccgccgagcacggcaaggtgcactccgacgcgctc
ggcgaggtcgcgcgcggcctggagatcgtggacctggcctgcggcatcaacgtacagctc
aagggcgagctgtcgacgcaggtcgcgacccgcgtggacgtgtcctcgatccggcagccg
ctcggtgtcgtcgcgggcatcacgccgttcaacttcccggcgatggtgccgctgtggatg
ttcccgatcgccatcgcctgcggcaacaccttcgtgctcaagccgagcgagaaggacccg
tcggccgccgtgaaggtcgccgagctgctctccgaggcgggtctgccggacggcgtcttc
aacgtcgtgcacggcgacaaggtggccgtggaccgactcctggagcacccggacgtcaag
gcggtctccttcgtcgggtcgaccccgatcgcccgctacatccacaccaccgcctccgcc
aacggcaagcgcgtgcaggcgctcggcggcgccaagaaccacatgctggtgctgcccgac
gccgacctcgacgcggcggccgacgcggcggtcagcgcggcctacggctcggccggcgag
cgctgcatggcgatctccgcggtcgtggcggtcggcgccgtcggcgacgaactggtggag
aagatccgcgagcgcgccgagaagatcaagatcggccccggcaccgacccgtcctccgag
atgggcccgctgatcaccaaggcgcaccgcgacaaggtcgcctcctacgtcgcgggcgcg
gcggccgagggctgcgaggtcgtcctggacggcaccggctacacggtcgacggccacgag
gacgggcactggatcggcatctccctgctcgaccgggtgccgaccaccgcgaaggcgtac
caggacgagatcttcggccccgtcctgtgcgtgctgcgcgccgacacgtacgaggagggc
gtggccctgatcaacgcctcgccgttcggcaacggcaccgcgatcttcacccgggacggc
ggcgcggcccgccgcttccagctggagatcgaggccggcatggtcggcgtgaacgtgccg
atcccggtcccggtgggctaccactccttcggtggctggaaggactcgctcttcggcgac
caccacatctacggcaacgacggcacgcacttctacacccgcggcaaggtcgtcaccacc
cgctggccggacccggccgacgccccggcgggagtggacctgggcttcccgcgcaaccac
tga

DBGET integrated database retrieval system