KEGG   Streptomyces coelicolor: SCO2769Help
Entry
SCO2769           CDS       T00085                                 

Gene name
SCC57A.40c
Definition
(RefSeq) acetolactate synthase
  KO
K01652  
acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine biosynthesis
Butanoate metabolism
C5-Branched dibasic acid metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO2769 (SCC57A.40c)
   01230 Biosynthesis of amino acids
    SCO2769 (SCC57A.40c)
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO2769 (SCC57A.40c)
   00660 C5-Branched dibasic acid metabolism
    SCO2769 (SCC57A.40c)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO2769 (SCC57A.40c)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO2769 (SCC57A.40c)
Enzymes [BR:sco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SCO2769 (SCC57A.40c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(3019967..3021661)
Genome map
AA seq 564 aa AA seqDB search
MTHDHDLVLRPTPAQTEAALNPPPGRTGGDLVVESLAALGATTVFGLPGQHALGVFDALR
RSDLRYIGLRVENNAGFAADAYGRITGEAAPLLLSTGPGALTSLAALQEARAASAPVLAI
GSQVPAAGLGGGRHGYLHELPDQAASFRGVVKSVHTARTQSQIPSAIAEAWTSALTVPHG
PVWVEIPQDVLLAETAIPVVTGGDTFPEELPPRPELTAVAADLLTRAERPAIIAGGGVVR
ADAAKKLRQLAERLQAPVVTTFGGKGAFPWTHPLSLQSWLEDRHTTDFLEDADVLLVIGS
GLGELSSNYHTFTPRGRVIQIEADLGKLESNHPALGIHADARLALQALLETVEEPRTDPT
APERVREVLDKVRARVAAQELTLEQDVLAAVRKALPSRAPSFWDMTILAYWAWSAFDPGA
PNTMHSAQGAGGLGYAFPAALGAAAADPTHPVLAVSGDGGALYSIAELATARQYGLNVTW
LIVDDGGYGILRAYMTDAFGTPTATATDLPGPDFVALAESFGVPGVRTSPETLARDLAKA
LATPGPSVVVLPAVLRMFAPTHAD
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgacccacgaccatgacctggtgctccgtccgaccccggcccagacggaggccgcgctg
aatcctccccccggccgcaccggcggggacctggtcgtggagtccctggccgcgctcggc
gcgaccaccgtcttcggcctgcccggccagcacgccctcggcgtgttcgacgccctgcgc
cgctccgacctgcgctacatcggcctgcgggtggagaacaacgccgggttcgccgccgac
gcctacggccggatcaccggcgaagcggccccgctgctgctgtccaccggtccgggagcc
ctcacctccctggccgcgctccaggaggcgcgggcagcctccgcgcccgtcctggcgatc
ggcagccaggtccccgcggcgggcctcggcggcggccgccacggctacctgcacgaactc
cccgaccaggccgcgtccttccgcggcgtggtcaagtccgtgcacaccgcccgcacccag
tcccagatcccgtccgcgatcgcggaggcctggacgtcggcactgaccgtcccgcacggc
ccggtgtgggtggagatcccgcaggacgtcctcctggccgagacggccatcccggttgtg
accggcggcgacaccttccccgaggaactgcccccgcgccccgaactgacggccgtcgcc
gccgacctgctcacccgcgccgagcgcccggcgatcatcgcgggcgggggagtggtccgc
gcggacgccgccaagaagctgcggcagctcgcggagcggctccaggcccccgtcgtcacg
accttcggcggcaagggcgccttcccctggacgcaccccctctccctccagtcctggctg
gaggaccgccacacgacggacttcctggaggacgccgacgtcctcctcgtgatcggctcg
ggcctcggcgaactctcctcgaactaccacacgttcaccccccgcggccgggtgatccag
atcgaggccgacctcggcaagctggagtccaaccacccggccctcggcatccacgccgac
gcccgcctcgccctccaggcgctgctggagacggtggaggagccgcgcacggacccgacc
gccccggaacgcgtccgcgaggtcctggacaaggtccgcgcacgcgtcgccgcccaggaa
ctcaccctggagcaggacgtcctggccgccgtccgcaaggccctcccgtcccgtgccccc
tccttctgggacatgaccatcctggcctactgggcgtggtcggccttcgaccccggggcc
ccgaacaccatgcactccgcccagggcgccggcggcctcggctacgccttcccggcggcc
ctgggcgccgcggcggccgaccccacccacccggtgcttgcggtctccggcgacggcggc
gccctgtactcgatcgccgagctggccaccgcccgccagtacggcctgaacgtcacctgg
ctcatcgtcgacgacggcggctacggcatcctgcgcgcgtacatgaccgacgccttcggc
actccgacggccacggcgacggacctgccgggccccgacttcgtcgccctggccgagtcg
ttcggagtccccggcgtacgcaccagccccgagaccctggcacgcgacctcgcgaaggca
ctggcgacgccgggcccgtcggtcgtcgtactccccgccgtcctgaggatgttcgcgccg
acgcacgcggactga

DBGET integrated database retrieval system