KEGG   Streptomyces coelicolor: SCO2774Help
Entry
SCO2774           CDS       T00085                                 

Gene name
acdH2, SCC105.05c
Definition
(RefSeq) acyl-CoA dehydrogenase
  KO
K00249  
acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO2774 (acdH2)
   01212 Fatty acid metabolism
    SCO2774 (acdH2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCO2774 (acdH2)
  Lipid metabolism
   00071 Fatty acid degradation
    SCO2774 (acdH2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO2774 (acdH2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO2774 (acdH2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     SCO2774 (acdH2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3025503..3026660)
Genome map
AA seq 385 aa AA seqDB search
MRRTVFNEDHEAFRETLRAFIEAEVVPVYDDWFAAGQAPREFYYKLGELGIFGINVPEEF
GGAGMDSHKFEAVLYEETARAGVQFGGSGVHVLLALPYINMLATDEQKKRYLPKFVTGEE
MWAIAMTEPGTGSDLAGMKSTAKLSEDGTHYVLNGAKTFITGGVHADRVIVCARTDAPTA
EDRRHGISLFAVDTKSEGYSVGRKLDKLGLRTSDTAELAFVDVKVPVEDLLGEENKGFSY
LGHNLASERWGIAFGAYAQAKAAVRFAKQYVQDRTVFGKPVAHFQNTKFELAACQAEVDA
AEAVVDRATEALDAGELTPAEAASAKLFCTEVAHRVIDRCLQLHGGYGYMNEYPIARLYA
DNRVNRIYGGTSEIMKSIIAKNMGL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgtacggtgttcaacgaggaccacgaggcgttccgggagaccctccgcgccttc
atcgaggccgaggtcgtccccgtctacgacgactggttcgccgcgggccaggcgccgcgc
gagttctactacaagctcggcgagctgggcatcttcggcatcaacgtgcccgaggagttc
ggcggcgccggcatggacagccacaagttcgaggccgtcctctacgaggagaccgcccgc
gcgggcgtccagttcggcggctccggcgtccacgtgctgctcgccctgccctacatcaac
atgctggccaccgacgagcagaagaagcgctacctgccgaagttcgtcaccggcgaggag
atgtgggccatcgcgatgaccgagccgggcaccggctccgacctcgcgggcatgaagtcc
accgccaagctctccgaggacggcacccactacgtcctcaacggcgccaagaccttcatc
accggcggcgtgcacgccgaccgcgtcatcgtctgcgcccgcaccgacgcgcccacggcc
gaggaccgccgccacggcatctccctgttcgccgtggacaccaagtccgagggctactcg
gtcggccgcaagctcgacaagctgggcctgcgcacctccgacaccgccgagctggccttc
gtcgacgtcaaggtccccgtcgaggacctgctcggcgaggagaacaagggcttctcctac
ctcggccacaacctggcctccgagcgctggggcatcgccttcggcgcctacgcgcaggcc
aaggccgccgtccggttcgccaagcagtacgtgcaggaccgcaccgtcttcggcaagccg
gtcgcccacttccagaacaccaagttcgagctggccgcctgccaggccgaggtggacgcc
gccgaggccgtcgtcgaccgcgcgaccgaggccctggacgccggcgagctgacccccgcc
gaggccgccagcgccaagctgttctgcaccgaggtcgcccaccgcgtcatcgaccgctgc
ctccagctgcacggcggctacggctacatgaacgagtacccgatcgcccgcctgtacgcg
gacaaccgcgtcaaccgcatctacggcggcaccagcgagatcatgaagtcgatcatcgcg
aagaacatgggcctgtag

DBGET integrated database retrieval system