KEGG   Streptomyces coelicolor: SCO2777Help
Entry
SCO2777           CDS       T00085                                 

Gene name
accC, SCC105.08
Definition
(RefSeq) acetyl/propionyl CoA carboxylase subunit alpha
  KO
K11263  
acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid biosynthesis
Tetracycline biosynthesis
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO2777 (accC)
   01212 Fatty acid metabolism
    SCO2777 (accC)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO2777 (accC)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO2777 (accC)
   00640 Propanoate metabolism
    SCO2777 (accC)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SCO2777 (accC)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO2777 (accC)
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    SCO2777 (accC)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SCO2777 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SCO2777 (accC)
    6.4.1.3  propionyl-CoA carboxylase
     SCO2777 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
3029169..3031109
Genome map
AA seq 646 aa AA seqDB search
MFDTVLVANRGEIAVRVIRTLRSMGVRSVAVFSDADADARHVREADDAVRIGPAPATESY
LSVERLLAAAARTGAQAVHPGYGFLAENAGFARACEEAGLVFIGPSADAIALMGDKIRAK
ETVRAAGVPVVPGSSGSGLTDEQLADAAREIGTPVLLKPSAGGGGKGMRLVRDTAVLADE
IAAARREARASFGDDTLLVERWIDRPRHIEIQVLADGHGGVVHLGERECSLQRRHQKVIE
EAPSVLLDEATRAAMGEAAVQAARSCGYRGAGTVEFIVPGSDPSQYYFMEMNTRLQVEHP
VTELVTGLDLVEWQLRVAAGEPLGFGQEDVRLTGHAIEARLCAEDPARGFLPSGGTVLRL
REPEGDGVRTDSGLSEGTEVGSLYDPMLSKVIAYGPDRETALRRLRAALAGTVTLGVQTN
AGFLRRLLAHPAVVAGELDTGLVEREVDGLVATDVPEEVYEAAAAVRLEALRPRGDGWTD
PFSVPSGWRMGGEPKAAAFHLRVTDPVEHTPRGTHTVTGDRVTVTLDGVRHTFHRAADWL
GRDGDAWQVRDHDPVAASLNRSAHAGADSLTAPMPGTVTVVKVAVGDEVSAGQSLLVVEA
MKMEHVISAPHAGTVAELDVAPGTTVAMDQVLAVIAPTDDATEETA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaccgtgctcgtcgccaaccgcggcgagatcgccgtccgcgtcatccggacg
ctgcgctcgatgggcgtgcgctcggtggcggtcttctccgacgccgacgcggacgcacgg
cacgtgcgggaggcggacgacgcggtacggatcggcccggcgcccgcgacggagagctat
ctgtccgtcgagcggctgctggcggcggcggcccggacgggggcgcaggccgtccacccg
ggatacggcttcctcgccgagaacgcgggtttcgcgcgggcctgcgaggaggcggggctg
gtcttcatcgggccgtccgccgacgcgatcgccctgatgggcgacaagatccgcgccaag
gagacggtgcgggcggccggggtgccggtcgtccccggctccagcggcagcgggctcacc
gacgagcagctcgccgacgccgcccgcgagatcggcaccccggtgctgctcaagccgtcg
gcgggcggtggcggcaagggcatgcggctggtgcgggacacggcggtgctggccgacgag
atcgccgccgcgcgccgcgaggcccgcgcctccttcggcgacgacacgctgctggtggag
cggtggatcgaccgtccccggcacatcgagatccaggtgctggccgacggccacgggggc
gtggtgcacctgggcgagcgcgagtgctcgctccagcgccgccaccagaaggtgatcgag
gaggcgcccagcgtcctgctggacgaggcgacccgggcggcgatgggcgaggcggccgtg
caggcggcccggtcctgcggctaccggggcgcgggcacggtggagttcatcgtgcccggg
agcgacccctcccagtactacttcatggagatgaacacccgtctccaggtcgagcacccg
gtgacggagctggtgaccggcctggacctggtggagtggcagctgcgggtggcggcgggc
gagccgctcgggttcgggcaggaggacgtacggctgaccgggcacgcgatcgaggcccgg
ctgtgcgcggaggacccggcgcgcggcttcctgccctccggcggcacggtgctgcggctg
cgcgagcccgagggcgacggcgtgcgcaccgactcggggctcagtgagggcaccgaggtc
ggcagcctctacgacccgatgctgtccaaggtgatcgcgtacggccccgaccgggagacc
gcgctgcgcaggctccgggcggcgctggccgggacggtcaccctgggcgtgcagaccaac
gccgggttcctgcggcggctgctcgcgcacccggcggtggtggcgggcgagctggacacg
gggctggtggagcgcgaggtcgacggcctggtcgccaccgacgtaccggaggaggtgtac
gaggcggcggcggccgtacggctggaggcgctgcgcccgcgcggggacggctggacggac
ccgttctcggtgccgagcggctggcggatgggcggcgagccgaaggcggccgccttccac
ctccgggtcaccgacccggtggaacacaccccgcgcggaacccacaccgtcaccggggac
cgggtcacggtcaccctggacggcgtccggcacaccttccaccgcgccgccgactggctg
ggccgcgacggcgacgcctggcaggtgcgcgaccacgacccggtggccgcctccctcaac
cggtccgcccacgcgggcgccgactcgctgaccgcgccgatgccgggcacggtgacggtg
gtgaaggtcgccgtcggcgacgaggtgagcgccgggcagagcctgctggtggtggaggcg
atgaagatggagcacgtcatctccgccccgcacgcgggcaccgtcgccgagctggacgtg
gcgccgggcacgacggtcgccatggaccaggtgctcgcggtcatcgcacccaccgacgac
gcgacggaggagacggcatga

DBGET integrated database retrieval system