KEGG   Streptomyces coelicolor: SCO2778Help
Entry
SCO2778           CDS       T00085                                 

Gene name
hmgL, SCC105.09
Definition
(RefSeq) hydroxymethylglutaryl-CoA lyase
  KO
K01640  
hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
sco  Streptomyces coelicolor
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Geraniol degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO2778 (hmgL)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SCO2778 (hmgL)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO2778 (hmgL)
  Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SCO2778 (hmgL)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     SCO2778 (hmgL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3031106..3032059
Genome map
AA seq 317 aa AA seqDB search
MNAPEPGLPMAVPAEGLPARVRIHEVGARDGLQNEKATVPTAVKAEFIRRLAGTGLTTIE
ATSFVHPKWVPQLADAEDLYPRISGLPVELPVLVPNERGLDRALALGARRVAVFASATES
FAKANLNRTVDEALAMFEPVVTRAKAQGDDVRVRGYLSMCFGDPWEGPVAVPQVVRVCRA
LLDMGCDELSLGDTIGVATPGHVTALLTALTGAGVPVSALGVHFHDTYGQALANTLAALQ
RGVTTVDASAGGLGGCPFAKSATGNLATEDLVWMLRGLGIDTGVDLGRLVATSVWMAAHL
GRPSPSRTVRALSHQES
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccccggaaccgggcctcccgatggccgtaccggccgagggactgcccgcccgc
gtccgcatccacgaggtcggcgcgcgcgacggactgcagaacgagaaggcgaccgtgccg
acggccgtcaaggcggagttcatccgccggctggccggcacgggcctgaccacgatcgag
gcgacgagcttcgtccaccccaagtgggtcccccagctggccgacgccgaggacctgtac
ccgcggatctccggcctgccggtggagctgccggtgctggtgccgaacgaacgcggcctg
gaccgggccctcgcgctcggcgcgcgccgggtcgcggtgttcgccagcgcgaccgagtcc
ttcgccaaggccaacctcaaccgcaccgtggacgaggcgctggccatgttcgagcccgtg
gtgacccgggcgaaggcgcagggcgacgacgtccgtgtacggggctacctctcgatgtgc
ttcggcgatccgtgggagggcccggtcgccgtcccccaggtggtgcgggtctgccgggcc
ctgctggacatgggctgcgacgagctgagcctcggcgacaccatcggggtggcgaccccg
ggccatgtgacggcgctgctcaccgcgctgaccggggcgggcgtgccggtctccgcgctg
ggcgtgcacttccacgacacctacggccaggccctggccaacacgctggccgcgctccag
cggggcgtcaccaccgtcgacgcctccgccggcgggctcggcggctgccccttcgcgaag
tccgccaccggcaacctcgccaccgaagacctcgtgtggatgctgcggggcctcggcatc
gacaccggggtcgacctcggccgtctcgtcgccacaagcgtctggatggccgcgcacctg
ggccggccgagcccgtcccgcaccgtacgagccctctcccaccaggagtcgtga

DBGET integrated database retrieval system