KEGG   Streptomyces coelicolor: SCO2779Help
Entry
SCO2779           CDS       T00085                                 

Gene name
acdH, SCC105.10
Definition
(RefSeq) acyl-CoA dehydrogenase
  KO
K11410  
short/branched chain acyl-CoA dehydrogenase [EC:1.3.99.12]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO2779 (acdH)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.12  2-methylacyl-CoA dehydrogenase
     SCO2779 (acdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
3032065..3033225
Genome map
AA seq 386 aa AA seqDB search
MDHKLSPELEELRRTVEQFAHDVVAPKIGDFYERHEFPYEIVREMGRMGLFGLPFPEEYG
GMGGDYFALGVALEELARVDSSVAITLEAGVSLGAMPLHLFGTEEQKREWLPRLCSGEIL
GAFGLTEPDGGSDAGATRTTARLDEATNEWVINGTKCFITNSGTDITGLVTVTAVTGRKP
DGRPLISSIIVPSGTPGFTVAAPYSKVGWNASDTRELSFADVRVPAANLLGELGRGYAQF
LRILDEGRVAIAALGTGLAQGCVDESVAYAKERHAFGRPIGANQAIQFKIADMEMKAHTA
RLAWRDAASRLVAGEPFKKEAALAKLYSSTVAVDNARDATQVHGGYGFMNEYPVARMWRD
AKILEIGEGTSEVQRMLIARELGLVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaccacaagctctcccccgaactggaagaactgcgccgtacggtcgaacagttcgcg
cacgacgtggtggcgcccaagatcggcgacttctacgagcggcacgagttcccgtacgag
atcgtccgcgagatgggccgcatgggcctgttcgggctgccgttcccggaggagtacggc
ggcatgggcggcgactacttcgccctcggcgtggccctggaggagctggcccgggtcgac
tcgtcggtggcgatcacgctggaggcgggtgtctcgctgggcgcgatgccgctgcacctg
ttcggcaccgaggagcagaagcgcgagtggctgccccggctctgctcgggcgagatcctg
ggcgcgttcggtctcaccgagccggacggcggcagcgacgcgggcgcgacccgtaccacg
gcccgcctggacgaggctacgaacgaatgggtcatcaacggcaccaagtgcttcatcacc
aactccggcacggacatcacgggcctggtcacggtcacggcggtgaccggccgcaagccc
gacggcaggcccctgatctcgtcgatcatcgtcccgtcgggcaccccgggcttcacggtg
gccgccccgtactcgaaggtcggctggaacgcctcggacacccgtgagctgtccttcgcc
gacgtccgggtcccggcggcgaacctgctgggcgagctggggcgcggctacgcgcagttc
ctgcgcatcctggacgagggccgggtggcgatcgccgcgctgggcacggggctcgcgcag
ggctgtgtggacgagtcggtcgcctacgcgaaggaacgtcacgccttcggcaggcccatc
ggcgccaaccaggccatccagttcaagatcgccgacatggagatgaaggcccacacggcc
cgtctcgcctggcgggacgcggcctcgcggctggtggcgggcgagccgttcaagaaggag
gcggcgctggcgaagctgtactcgtcgacggtcgcggtggacaacgcccgggacgccacc
caggtccacggcggctacggtttcatgaacgagtacccggtggcccgcatgtggcgggac
gcgaagatcctggagatcggcgagggcaccagcgaggtccagcggatgctgatcgcacgg
gagttggggctggtgggctga

DBGET integrated database retrieval system