KEGG   Streptomyces coelicolor: SCO2789Help
Entry
SCO2789           CDS       T00085                                 

Gene name
glmS2, SCC105.20
Definition
(RefSeq) glucosamine-fructose-6-phosphate aminotransferase
  KO
K00820  
glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCO2789 (glmS2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO2789 (glmS2)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     SCO2789 (glmS2)
Peptidases [BR:sco01002]
 Cysteine Peptidases
  Family C44
   SCO2789 (glmS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3043786..3045603
Genome map
AA seq 605 aa AA seqDB search
MCGIVGYIGKRDVAPLLLEGLQRLEYRGYDSAGIVVTSPKAAGLRMVKAKGRVRDLEAKV
PARFKGTTGIAHTRWATHGAPSDVNAHPHMSADNKVAVVHNGIIDNAADLRRKLEADGVE
FLSETDTEVLVHLIARSEAEKLEDKVRETLRVIEGTYGIAVMHADFPERIVVARNGSPVV
LGIGEKEMFVASDIAALVAHTRQIVTLDDGEMATLKADDFRTYTTEGTRTTSEPTTVEWE
AASYDMGGHDTYMHKEIHEQAEAVDRVLRGRIDDRFSTVHLGGLNLDARDARAVRRVKIL
GCGTSYHAGQIGAQMIEELARIPADAEPASEFRYRNAVVDPDTLYIAVSQSGETYDVLAA
VQELKRKGARVLGIVNVVGSAIAREADGGMYVHAGPEVCVVSTKCFTNTCVAFALLALHL
GRTRDLSVRDGKRIIEGLRKLPAQIEEMLKQEEDVKKLAAQYAEARSMLFIGRVRGYPVA
REASLKLKEVSYIHAEAYPASELKHGPLALIEPALPTVAIVPDDDLLEKNRAALEEIKAR
SGQILAVAHQEQEKADHTIVVPKNEDELDPILMGIPLQLLAYHTALALGRDIDKPRNLAK
SVTVE
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgtcggatacatcggcaagcgtgacgtcgcccccctgctcctggagggt
ctccagcgcctggagtaccgcgggtacgactcggcgggcatcgtggtgacctccccgaag
gcggccggcctgaggatggtcaaggccaagggccgggtgcgcgacctggaggccaaggtc
ccggcgcgcttcaagggcaccaccggcatcgcccacacccgctgggccacccacggcgcc
ccctccgacgtgaacgcccacccgcacatgtcggccgacaacaaggtcgccgtcgtccac
aacggcatcatcgacaacgccgccgacctgcgccgcaagctggaggcggacggcgtcgag
ttcctctccgagaccgacaccgaggtcctcgtccacctcatcgcccgctccgaggcggag
aagctggaggacaaggtccgcgagaccctgcgggtcatcgagggcacgtacggcatcgcc
gtgatgcacgccgacttccccgaacgcatcgtggtcgcccgcaacggctcgccggtcgtc
ctcggcatcggcgagaaggagatgttcgtcgcctcggacatcgccgcgctggtcgcccac
acccggcagatagtcacgctcgacgacggcgagatggccaccctcaaggccgacgacttc
cgcacctacaccaccgagggcacccgcaccacgtcggagcccaccaccgtggagtgggag
gccgcctcctacgacatgggcggccacgacacctacatgcacaaggagatccacgagcag
gccgaggccgtggaccgcgtgctgcgcggccggatcgacgaccgcttctccaccgtgcac
ctcggcggcctcaacctggacgcccgcgacgcgcgcgccgtgcgccgcgtgaagatcctg
ggctgcggcacctcgtaccacgcgggccagatcggcgcccagatgatcgaggagctggcc
cgcatccccgcggacgccgagccggcctccgagttccgctaccgcaacgcggtcgtcgac
cccgacaccctgtacatcgccgtctcccagtccggcgagacctacgacgtgctggccgcc
gtgcaggagctgaagcgcaagggcgcccgcgtcctcggcatcgtcaacgtcgtgggctcg
gcgatcgcccgcgaggccgacggcgggatgtacgtgcacgccggccccgaggtctgcgtg
gtgtcgaccaagtgcttcaccaacacctgcgtcgccttcgcgctgctcgccctgcacctg
ggccgcacccgcgacctctccgtccgcgacggcaagcggatcatcgaggggttgcgcaag
ctgcccgcgcagatcgaggagatgctgaagcaggaggaggacgtcaagaagctggccgcg
cagtacgccgaggcccgctcgatgctcttcatcggccgggtgcggggctacccggtcgcc
cgcgaggcctccctgaagctcaaggaggtctcctacatccacgccgaggcctacccggcc
tccgagctgaagcacggcccgctcgccctgatcgagccggccctgccgaccgtcgcgatc
gtgccggacgacgacctgctggagaagaaccgcgcggccctggaggagatcaaggcccgc
agcggtcagatcctcgctgtggcccaccaggagcaggagaaggccgaccacacgatcgtc
gtcccgaagaacgaggacgagctggacccgatcctcatgggcatcccgctccagctcctc
gcgtaccacacggctctggccctgggccgggacatcgacaagccccgcaacctcgccaag
tccgtgacggtggagtag

DBGET integrated database retrieval system