KEGG   Streptomyces coelicolor: SCO2796Help
Entry
SCO2796           CDS       T00085                                 

Gene name
2SCC13.04
Definition
(RefSeq) cellobiose transport permease
  KO
K10241  
cellobiose transport system permease protein
Organism
sco  Streptomyces coelicolor
Pathway
ABC transporters
Module
Cellobiose transport system
Brite
KEGG Orthology (KO) [BR:sco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SCO2796 (2SCC13.04)
Transporters [BR:sco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Cellobiose transporter [MD:M00206] [OT]
    SCO2796 (2SCC13.04)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
3052589..3053602
Genome map
AA seq 337 aa AA seqDB search
MTTRHDTAASPVKGGAAPGRPPGGRASAEADRRKRAKLSRRWQRDMRWSPYAFVSPFFLL
FLAFGLFPLIYTGWASLHTVELTAPTDMQWTGLDNYTRIFDDEFFWNAAKNTLWIGVIST
VPQLLMAMGLAHILNYKLRASTFYRVVMLAPYATSIAAASLVFVLLFGRDYGMINWVLDL
VGLDKIDWQNGSWSSKFAVSTIVIWRWTGYNALIYLAAMQAIPQDLYESAALDGASRWRQ
FIHVTLPSLRPTILFTVVVSTIGASQVFGEPLLFDANKGASGGSQHQFQTLGLYLYEQGW
VNQHLGRASAIAWAMFLILIVIGVLNAVISRRLRASS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccggcacgacaccgccgcgtcccccgtcaaggggggcgcggccccgggccgc
ccgcccggcggcagggcgtccgcggaggcggaccgcaggaagcgggccaagctctcccgc
cgctggcagcgggacatgcgctggagcccgtacgcgttcgtctcgccgttcttcctgctc
ttcctcgccttcggcctgttcccgctgatctacaccggctgggcctcgctgcacacggtg
gagctgaccgcgcccaccgacatgcagtggacggggctggacaactacacccggatcttc
gacgacgagttcttctggaacgccgcgaagaacacactgtggatcggcgtcatctcgacg
gtgccgcagctgctgatggcgatgggcctcgcgcacatcctcaactacaagctgcgcgcc
tcgaccttctaccgggtcgtgatgctggcgccgtacgcgacgtcgatcgccgcggcctcg
ctggtcttcgtgctgctcttcggccgggactacggcatgatcaactgggtcctcgacctg
gtgggcctggacaagatcgactggcagaacggctcgtggtcgtccaagttcgccgtgtcc
acgatcgtcatctggcgctggaccggctacaacgcgctgatctacctggccgcgatgcag
gcgatcccgcaggacctgtacgagtcggcggcgctggacggcgccagccgctggcggcag
ttcatccacgtcacgctgccctcgctgcgtcccacgatcctgttcacggtcgtcgtgtcg
accatcggcgcctcgcaggtcttcggcgagccgctgctcttcgacgccaacaagggcgcc
tcgggcggctcccagcaccagttccagacgctcggcctgtacctgtacgagcagggctgg
gtcaaccagcacctgggccgcgcctccgcgatcgcctgggcgatgttcctgatcctgatc
gtgatcggggtcctcaacgccgtcatctcgcgccggctgcgcgccagtagttaa

DBGET integrated database retrieval system