KEGG   Streptomyces coelicolor: SCO2797Help
Entry
SCO2797           CDS       T00085                                 

Gene name
2SCC13.05
Definition
(RefSeq) cellobiose transport permease
  KO
K10242  
cellobiose transport system permease protein
Organism
sco  Streptomyces coelicolor
Pathway
ABC transporters
Module
Cellobiose transport system
Brite
KEGG Orthology (KO) [BR:sco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SCO2797 (2SCC13.05)
Transporters [BR:sco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Cellobiose transporter [MD:M00206] [OT]
    SCO2797 (2SCC13.05)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3053615..3054526
Genome map
AA seq 303 aa AA seqDB search
MTTTMTKPPADAAPEPPRRGRRRSKASRAGGTLHAGPVAYIILALFTIGSLFPLVWTAIA
ASRDNQRLAQTPPPLWFGGNLFDKLEIAWNDANLGEAFLNTTIVAGISACTIVFLSTVAG
FAFAKLRFRGRNALMLIVVGTMMVPPQLSIIPLYMMVAKLDWSDQLQAVILPSLVNAFGV
FFMRQYLLQALPDEIIEAARVDGASSWRVMWHVVFPAARPAMAVLGMLMFVQSWNDFLWP
FLVLTQNGSPTVQVALAGLGRGYTPDQSLIMAGALLGTLPLLLVFAIFGKQIVGGIMQGA
VKG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgaccatgacgaaacccccggccgacgcggcacccgagccgccccggcggggc
cgacgacgttccaaggcatcccgggccggtggcacgctgcacgccgggccggtcgcctac
atcatcctcgccctgttcaccatcggctcgctgttcccgctggtgtggacggcgatcgcc
gcctcgcgcgacaaccagcggctcgcccagacaccgccgcccctctggttcggcggcaac
ctgttcgacaagctcgagatcgcctggaacgacgccaacctcggcgaggcgttcctcaac
accaccatcgtggccgggatctcggcgtgcaccatcgtcttcctgtcgacggtcgccggg
ttcgccttcgccaagctgcgcttccgcgggcgcaacgcgctgatgctgatcgtcgtcggc
acgatgatggtgccgccgcagctcagcatcatcccgctgtacatgatggtcgcgaagctg
gactggtccgaccagttgcaggcggtgatcctgccgtccctggtgaacgcgttcggcgtg
ttcttcatgcggcagtacctgctccaggcgctgcccgacgagatcatcgaggccgcgcgc
gtggacggcgccagcagctggcgtgtgatgtggcacgtggtgttcccggcggcgcggccc
gcgatggccgtgctcggcatgctgatgttcgtgcagtcctggaacgacttcctgtggccg
ttcctggtgctgacgcagaacggcagcccgaccgtgcaggtcgcactcgccggactgggc
cgcggctacaccccggaccagtccctgatcatggccggtgcgctgctgggcacgctgccg
ctgctgctggtgttcgcgatcttcggcaagcagatcgtgggcggcatcatgcagggcgcc
gtcaagggctga

DBGET integrated database retrieval system