KEGG   Streptomyces coelicolor: SCO2910Help
Entry
SCO2910           CDS       T00085                                 

Gene name
SCE19A.10c
Definition
(RefSeq) cysteine synthase
  KO
K21148  
[CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase [EC:2.5.1.113]
Organism
sco  Streptomyces coelicolor
Pathway
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    SCO2910 (SCE19A.10c)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.113  [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase
     SCO2910 (SCE19A.10c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3161747..3162697)
Genome map
AA seq 316 aa AA seqDB search
MRYDSPLAAVGNTPLVRLPRLSPSDDVRIWAKLEDRNPTGSIKDRPALHMIEQAEKDGRL
TQGCTILEPTSGNTGISLAMAARLKGYRIVCVMPENTSQERRDLLTMWGAEIISSPAAGG
SNTAVRVAKELSAEHPDWVMLYQYGNPDNAGAHYAGTGPEILADLPSVTHFVAGLGTTGT
LMGVGRYLREHKPDVKIVAAEPRYDDLVYGLRNLDEGFVPELYDASVLTTRFSVGSADAV
TRTRELLQQEGIFAGVSTGAALHAAIGVGKKAVKAGESADIVFVVADGGWKYLSTGVYTA
ETTEAAIETLHGQLWA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgactccccgctggccgcggtgggcaacacccccctggtgcgcctgccgcgg
ctgtcgccgtccgacgacgtccgcatctgggccaagctggaggaccgcaacccgaccggc
tcgatcaaggatcgccccgcgctccacatgatcgagcaggccgagaaggacggccgcctc
acccagggctgcaccatcctggagccgaccagcggaaacaccggcatctccctggccatg
gccgccaggctcaagggctaccgcatcgtctgcgtcatgcccgagaacacctcccaggaa
cgccgggacctgctcaccatgtggggcgcggagatcatctcctccccggccgcgggcggc
tccaacaccgccgtacgcgtcgccaaggaactctccgccgaacacccggactgggtgatg
ctctaccagtacggcaacccggacaacgcgggcgcccactacgccggcaccggccccgag
atcctcgccgacctgccgtcggtcacgcacttcgtcgcgggcctgggaacgacggggacg
ctgatgggcgtcggccgctacctgcgcgagcacaagccggacgtgaagatcgtcgccgcc
gaaccgcgctacgacgacctggtctacggcctgcgcaacctcgacgagggcttcgtcccc
gagctgtacgacgcctccgtcctcaccacccgcttctcggtgggctccgccgacgcggtc
acccgcacccgcgagctgctccagcaggagggcatcttcgcgggcgtctccaccggcgcc
gccctgcacgccgcgatcggcgtcgggaagaaggcggtcaaggcgggggagagcgcggac
atcgtgttcgtcgtcgccgacggcggctggaagtacctgtcgaccggcgtctacaccgcc
gagacgaccgaggcggccatcgagaccctgcacggccagctctgggcctga

DBGET integrated database retrieval system