KEGG   Streptomyces coelicolor: SCO2925Help
Entry
SCO2925           CDS       T00085                                 

Gene name
SCE19A.25c
Definition
(RefSeq) oxidoreductase subunit
  KO
K00104  
glycolate oxidase [EC:1.1.3.15]
Organism
sco  Streptomyces coelicolor
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO2925 (SCE19A.25c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     SCO2925 (SCE19A.25c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(3175582..3177048)
Genome map
AA seq 488 aa AA seqDB search
MIMSRIEAPRDEDDAAAAVDSTPGSTPGSPLGDRSTLVGRLLAGLPAGSVLTDPDVTASY
ANDMASFCPAGAPAAVVLPRTVEDVQHVMRTATALRVPVVPQGARTGLSGAANATDGCVV
LSLTKMDRILEINPVDRVAVVEPGVVNATLSRAVNEHGLYYPPDPSSWEMCTIGGNIGTA
SGGLCCVKYGVTAEYVLGLDVVLADGRLMSTGRRTAKGVAGYDLTRLFVGSEGSLGIVVK
AVLGLRPKPPEQLVLAAEFASASAACDAICRIMEGGHVPSLLELMDRTTVKAVNDLAHMG
LPESTEALLLAAFDTTDPAADLAAVGALCEAAGATQVVPAEDAAESELLLQARRLALTAL
EAVKGTTMIDDVCVPRSRLGDMLEGIDRVAAKYGLTIGVCAHAGDGNTHPTVCFDVQDPD
ESRRARESFDEIMALGLELGGTITGEHGVGVLKKEWLAREIGPVGLEMQRAVKEVFDPLG
ILNPGKLF
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatgagccgtatcgaagcgcctcgcgacgaagacgacgcagccgcggcggtcgac
agcacccccggcagcacccccggcagtcccctcggcgaccggagcaccctcgtcggccgg
ctgctggccggtctgcccgccgggtccgtcctcaccgatcccgacgtcacggcctcctac
gccaacgacatggcgagcttctgcccggccggcgcccccgccgcggtcgtcctgccgcgc
accgtggaggacgtccagcacgtcatgcgcaccgccaccgcactgcgcgtcccggtggtc
ccgcagggcgcccgcaccggtctgtccggcgcggccaacgccaccgacggctgcgtggtc
ctctccctgacgaagatggaccgcatcctggagatcaacccggtcgaccgggtcgccgtc
gtcgaaccgggcgtcgtcaacgccacgctgtcccgcgcggtgaacgaacacggcctctac
tacccgccggacccctccagctgggagatgtgcacgatcggcggcaacatcggcaccgcc
tccggcggcctgtgctgcgtcaagtacggggtgaccgccgagtacgtcctcggcctcgac
gtcgtcctcgccgacggccgcctgatgtccaccgggcgccgcaccgccaagggcgtcgcc
gggtacgacctcacccggctcttcgtgggctccgagggctcactcggcatcgtggtgaag
gcggtcctcgggctgcgccccaagccgcccgagcagctggtgctggccgccgagttcgcc
tccgcgtccgccgcctgcgacgcgatctgccggatcatggaagggggccacgtcccctcc
ctcctcgaactgatggaccgtacgaccgtcaaggcggtcaacgacctcgcccacatgggc
ctcccggagagcaccgaggcgctcctgctcgccgccttcgacaccaccgacccggccgcc
gacctcgccgccgtcggcgccctgtgcgaggccgccggcgccacccaggtggtcccggcc
gaggacgccgccgagtccgaactcctcctccaggccaggcgcctggccctcaccgccctc
gaagccgtcaagggcaccacgatgatcgacgacgtgtgcgtgccccgctcccggctcggc
gacatgctggagggcatcgaccgggtcgccgccaagtacggcctcaccatcggggtctgc
gcccacgcgggcgacggcaacacccaccccaccgtctgcttcgacgtccaggaccccgac
gagtcccggcgggcccgcgagtccttcgacgagatcatggcgctcggcctggaactcggc
ggcaccatcaccggcgagcacggcgtgggcgtcctgaagaaggagtggctggcgcgggag
atcggcccggtgggcctggagatgcagcgggccgtcaaggaggtcttcgacccgctgggc
atcctcaacccgggcaagctcttctga

DBGET integrated database retrieval system