KEGG   Streptomyces coelicolor: SCO2951Help
Entry
SCO2951           CDS       T00085                                 

Gene name
SCE59.10c
Definition
(RefSeq) malate oxidoreductase
  KO
K00027  
malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
sco  Streptomyces coelicolor
Pathway
Pyruvate metabolism
Carbon metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO2951 (SCE59.10c)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCO2951 (SCE59.10c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     SCO2951 (SCE59.10c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3207037..3208452)
Genome map
AA seq 471 aa AA seqDB search
MATAPSVSYSMTVRLEVPAGGTAVSQLTTAVESAGGSVTGLDVTASGHDKLRIDVTIAAG
STAHADEIVEQLRGIEGVSLGKVSDRTFLMHLGGKIEMQSKHPIRNRDDLSMVYTPGVAR
VCMAIAENPEDARRLTIKRNSVAVVTDGSAVLGLGNIGPKAALPVMEGKAALFKRFAGID
AWPICLDTQDTDAIVEIVKAIAPGFAGINLEDISAPRCFEIEARLREALDIPVFHDDQHG
TAIVVLAALTNALRVVGKGIENVRVVMSGAGAAGTAILKLLLAAGVKNAVVADIHGVVHT
GRADLVDAAPESALRWIADNTNPEGLTGTLKEAVHGADVFIGVSAPNVLDGEDVAAMADG
AIVFALANPDPEVDPAIARETAAVVATGRSDFPNQINNVLVFPGVFRGLLDAQSRTVNTE
MMLAAAHALANVVTEDEINPNYIIPSVFNDKVAGAVAGAVRDAAKAAGVVA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggcgcccagcgtctcctactcgatgacggtccgactggaggtgcccgccggc
ggaaccgccgtctcgcagctcaccacggcggtggagtccgccggcggctcggtcaccggc
ctcgacgtcacggcctcgggccacgacaagctccgcatcgacgtcaccatcgcggccggc
tcgaccgcccacgccgacgagatcgtggagcagctgcggggcatcgagggcgtcagcctc
ggcaaggtctcggaccgtaccttcctcatgcacctcggcggcaagatcgagatgcagtcc
aagcaccccatccgcaaccgcgacgacctgtccatggtctacacgcccggcgtggcgcgg
gtctgcatggcgatcgccgagaaccccgaggacgcccgccgcctcaccatcaagcgcaac
tccgtcgcggtcgtgaccgacggctccgccgtgctgggcctgggcaacatcggcccgaag
gccgcgctgccggtgatggagggcaaagcggccctgttcaagcggttcgccgggatcgac
gcctggccgatctgcctggacacccaggacaccgacgcgatcgtcgagatcgtcaaggcc
atcgccccgggcttcgccggcatcaacctggaggacatctcggcgccccgctgcttcgag
atcgaggcccggctgcgcgaggccctggacatccccgtattccacgacgaccagcacggc
accgccatcgtcgtcctcgccgcgctgaccaacgccctgcgcgtggtgggcaagggcatc
gagaacgtacgggtcgtcatgtccggcgccggcgcggccggtacggccatcctcaagctg
ctgctcgccgccggggtcaagaacgccgtcgtcgccgacatccacggcgtcgtgcacacg
ggccgggcggacctggtggacgccgcgcccgagtcggccctgcgctggatcgccgacaac
accaaccccgagggcctcaccggcaccctcaaggaagccgtgcacggcgccgacgtcttc
atcggcgtctccgcacccaacgtcctggacggcgaggacgtggccgccatggccgacggc
gcgatcgtgttcgcgctcgcgaaccccgaccccgaggtggacccggcgatcgcccgggag
acggccgcggtcgtcgccaccggccgctcggacttcccgaaccagatcaacaacgtgctg
gtcttcccgggcgtcttccgcggcctgctggacgcccagtcccgcaccgtcaacaccgag
atgatgcttgcggccgcacacgccctcgcgaacgtggtgaccgaggacgagatcaacccg
aactacatcatccccagcgtcttcaacgacaaggtcgccggtgccgtcgcgggcgccgta
cgggacgcggcgaaggccgccggagtggtggcgtag

DBGET integrated database retrieval system