KEGG   Streptomyces coelicolor: SCO3023Help
Entry
SCO3023           CDS       T00085                                 

Gene name
sahH, SCE34.04c
Definition
(RefSeq) adenosylhomocysteinase
  KO
K01251  
adenosylhomocysteinase [EC:3.3.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine degradation
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO3023 (sahH)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.1  Thioether and trialkylsulfonium hydrolases
    3.3.1.1  adenosylhomocysteinase
     SCO3023 (sahH)
Protein phosphatases and associated proteins [BR:sco01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SCO3023 (sahH)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO3023 (sahH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3305155..3306612)
Genome map
AA seq 485 aa AA seqDB search
MTTVDNRQDFKVADLSLAAFGRKEITLAEHEMPGLMAIRKEYAEAQPLAGARVTGSLHMT
VQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAVGPNGTPDNPQGVPVFAWKGETLE
EYWWCTEQALTWPNTPTGGPNMILDDGGDATLLVHKGVEYEKDGKVPSVDTAESDEHRVI
LELLTRTVGESPQKWTQLASEIRGVTEETTTGVHRLYEMHRDGTLLFPAINVNDAVTKSK
FDNKYGCRHSLIDGINRATDVLIGGKTAVVCGYGDVGKGCAESLRGQGARVIITEIDPIC
ALQAAMDGFQVTTLDEVVDKADIFVTTTGNKDIIMAKDMAKMKHQAIVGNIGHFDNEIDM
AGLAQTPGIVKDEVKPQVHTWTYPDGKVLIVLSEGRLLNLGNATGHPSFVMSNSFADQTL
AQIELFTKPDEYPTDVYVLPKHLDEKVARLHLDSLGVKLTTLRPEQADYIGVKVEGPYKA
DHYRY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgtcgacaaccgacaggacttcaaggtcgccgacctctccctggccgcgttc
ggccgcaaggagatcaccctcgccgagcacgagatgcccggcctcatggcgatccgcaag
gagtacgccgaggcccagccgctcgccggcgcccgcgtcaccggctccctgcacatgacc
gtgcagaccgccgtgctcatcgagaccctcgtcgccctcggcgccgaggtccgctgggcc
tcctgcaacatcttctccacccaggaccacgcggccgccgccatcgccgtcggcccgaac
ggcacgcccgacaacccgcagggcgtccccgtcttcgcctggaagggcgagaccctcgag
gagtactggtggtgcacggagcaggcgctgacctggccgaacacccccaccggcggcccg
aacatgatcctggacgacggcggtgacgccaccctcctcgtccacaagggcgtcgagtac
gagaaggacggcaaggtcccctcggtcgacaccgccgagtccgacgagcaccgcgtcatc
ctcgaactcctcacccgcacggtcggcgagagcccgcagaagtggacccagctggcgtcc
gagatccgcggtgtcaccgaggagaccacgaccggcgtccaccgcctgtacgagatgcac
cgcgacggcaccctgctgttcccggcgatcaacgtcaacgacgcggtcaccaagtcgaag
ttcgacaacaagtacggctgccgccactccctgatcgacggcatcaaccgcgccaccgac
gtcctgatcggcggcaagaccgccgtcgtctgcggctacggcgacgtcggcaagggctgc
gcggagtccctgcgcggccagggcgcccgcgtgatcatcaccgagatcgacccgatctgc
gccctgcaggcggcgatggacggcttccaggtcaccacgctggacgaggtcgtcgacaag
gccgacatcttcgtcaccacgaccggcaacaaggacatcatcatggccaaggacatggcc
aagatgaagcaccaggccatcgtcggcaacatcggccacttcgacaacgagatcgacatg
gccggcctcgcccagacccccggcatcgtcaaggacgaggtcaagccgcaggtccacacc
tggacctaccccgacggcaaggtgctcatcgtcctctccgagggccgcctgctgaacctg
ggcaacgccaccggccacccgtcgttcgtgatgtccaactccttcgcggaccagaccctg
gcccagatcgagctgttcaccaagcccgacgagtacccgaccgacgtctacgtgctgccc
aagcacctggacgagaaggtcgcccggctccacctcgactccctcggcgtcaagctgacc
acgctccgcccggagcaggccgactacatcggcgtcaaggtcgagggcccctacaaggcg
gaccactaccgctactga

DBGET integrated database retrieval system