KEGG   Streptomyces coelicolor: SCO3025Help
Entry
SCO3025           CDS       T00085                                 

Gene name
manA, SCE34.06c
Definition
(RefSeq) mannose-6-phosphate isomerase
  KO
K01809  
mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
sco  Streptomyces coelicolor
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SCO3025 (manA)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO3025 (manA)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     SCO3025 (manA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(3307981..3309132)
Genome map
AA seq 383 aa AA seqDB search
MDRLDNTVRPYAWGSTTAIPTLLGTEPTGEPQAEMWMGAHPGAPSRTGRGTLAEVVDADP
EKELGAASVARFGPRLPFLLKLLAAGAPLSLQVHPDLAQARAGYEDEERRGVPLDAPHRN
YKDANHKPELVCALTDFDGLCGFRAPAETADLLDGLGVASLKPYVDLLRAHPEDAALREV
LTAILTADPEEMSHTVTETAAACDRLGGAYRPYADIAHHYPGDPGVLAAMLLNHVRLQPG
EALYLGAGIPHAYLNGLGVEIMANSDNVLRCGLTPKHVDVPELLRIVRFEAGDPGILRPE
ASPDGEEVYDTPIDEFRLSRYVLPEGAGAHDLTLPTPQILLCTAGTVRAGEHELAPGRSV
FVPAHEKAEVSGTGTLFRATVRV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcctcgacaacaccgtccgcccctacgcctggggttccaccaccgcgatcccg
accctgctcgggaccgagccgaccggcgaaccgcaggcggagatgtggatgggcgcccac
cccggcgccccctcccgcaccggccggggcaccctcgccgaggtcgtcgacgccgacccc
gagaaggaactgggcgccgcgtccgtggccaggttcggcccccggctgcccttcctcctc
aagctcctcgccgccggcgccccgctctccctccaggtccaccccgacctcgcccaggcc
agggccggttacgaggacgaggagcgccgcggcgtccccctggacgccccgcaccgcaac
tacaaggacgccaaccacaagcccgaactggtctgcgccctcaccgacttcgacggcctg
tgcggcttccgcgccccggccgagacggccgacctgctcgacggcctgggcgtcgcctcc
ctcaagccgtacgtcgacctgctgcgcgcccaccccgaggacgccgccctgcgcgaggtc
ctcaccgcgatcctcaccgccgaccccgaggagatgtcccacaccgtcaccgagaccgcg
gccgcctgcgaccgcctcggcggcgcctaccggccgtacgccgacatcgcccaccactac
ccgggcgaccccggcgtcctcgccgcgatgctcctcaaccacgtccggctccagcccggc
gaggccctctacctcggcgccggcatcccccacgcctacctcaacggcctcggcgtcgag
atcatggccaactccgacaacgtcctgcgctgcgggctcacccccaagcacgtcgacgtc
cccgaactcctgcgcatcgtccgcttcgaggccggcgaccccggcatcctgcgcccggag
gcgtcccccgacggcgaagaggtctacgacaccccgatcgacgagttccgcctgagccgc
tacgtcctgcccgagggcgccggcgcccacgacctgaccctgcccaccccgcagatcctg
ctctgcacggcgggcaccgtacgagcgggcgaacacgaactggcccccggccgctcagtc
ttcgtaccggcgcacgaaaaggccgaagtgtccggaaccggcacgctcttccgggccacc
gtgcgcgtctga

DBGET integrated database retrieval system