KEGG   Streptomyces coelicolor: SCO3029Help
Entry
SCO3029           CDS       T00085                                 

Gene name
SCE34.10c
Definition
(RefSeq) L-lactate permease
  KO
K03303  
lactate permease
Organism
sco  Streptomyces coelicolor
Brite
Transporters [BR:sco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SCO3029 (SCE34.10c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3312276..3313892)
Genome map
AA seq 538 aa AA seqDB search
MYVQELEPVAGSLGLSALVAALPLVIVLVLLGGVRMKAHLAGLIGLLAAVLVAWLAYGMP
LDQTASSAVQGAVFGLFPILWIVVNALWVYRMTVRTRHFDILRRSFGRLSDDPRIQALVV
AFCFGALLEALAGFGAPVAICSVMLVALGFDPVRAAVVSLVANTAPVAFGAMGTPVVTLA
QVTGLPLDDVASVVGRQTPLLALVVPLLLVALVDGRRGLRETWIPALACGVAFAVAQFVA
SNYVSAQLADIAAALIGAGALVAVPHSRRPAAEPVRASVLTGARSEELDERDSAREVVRA
YAPYALIVAVFSVAQIPAVKDWLAKATQSYDWPFLDVMDPEGKPVGGNVFSWPIVSTGGT
LVLFAGLATAVVLGVHARVAVKEWLATVHELRFAILTVTSVLALAYVMNLSGQAATIGHF
VAAAGAGLAFLSPVLGWFGVAVSGSDTSANALFGALQVTAARESGLSPELLAAANSSGGV
LGKMISPQNLTIACAAVGLAGREGDLLRKVLPWSLGLLLVMCLIVVGQSTAVLGWMLP
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgtgcaggaactggaacccgtcgccggttcgctcggcctgtccgccctggtggcg
gccctgccactggtgatcgtcctcgtgctgctgggcggcgtccgcatgaaggcgcacctg
gcgggcctcatcggcctcctggccgccgtactggtcgcctggctcgcctacggcatgccg
ctggaccagacggcctccagcgccgtccagggagcggttttcggcctcttccccatcctg
tggatcgtcgtgaacgccctgtgggtctaccggatgaccgtccgcacccggcacttcgac
atcctgcgccgctccttcggccggctgtccgacgacccccgcatccaggccctcgtcgtc
gccttctgcttcggcgccctcctggaggccctcgccgggttcggggcgcccgtcgcgatc
tgctcggtcatgctcgtcgccctcggcttcgaccccgtacgcgccgccgtcgtctcgctg
gtcgccaacaccgcaccggtcgccttcggcgcgatgggcaccccggtggtgacgctggcc
caggtcaccgggctgcccctggacgacgtcgcctccgtggtgggccgccagacgcctctg
ctggccctcgtcgtaccgctgctcctggtcgccctggtggacggacggcgcggactgcgc
gagacctggatcccggcactggcctgcggggtcgccttcgccgtcgcccagttcgtcgcc
tccaactacgtctccgcccagctcgccgacatcgccgccgccctgatcggcgccggtgcc
ctggtcgccgtaccgcactcccgccggcccgccgccgagcccgtacgggcgtccgtgctg
accggcgcgcgcagcgaggaactggacgagcgggactccgcccgcgaggtcgtgcgggcg
tatgcgccgtacgcgctgatcgtcgccgtcttctccgtggcccagatccctgcggtcaag
gactggctggccaaggccacgcagtcctacgactggccgttcctggacgtgatggacccc
gagggcaagccggtcggcggcaacgtgttctcctggccgatcgtctccaccggcggcacg
ctcgtgctcttcgccgggctggccacggccgtcgtcctcggcgtgcacgcgcgcgtggcg
gtcaaggagtggctcgcgaccgtgcacgaactgcggttcgcgatcctcaccgtcacctcg
gtcctcgccctcgcctacgtcatgaacctctccgggcaggccgccaccatcggccacttc
gtcgccgcggccggtgccggactcgccttcctctccccggtcctcggctggttcggcgtc
gccgtctccggctccgacacctccgccaacgcgctcttcggcgccctccaggtgaccgcc
gcgcgggagtccggtctctcgcccgaactgctggccgccgccaacagctccggcggcgtc
ctcggcaagatgatctccccgcagaacctcaccatcgcctgcgccgccgtcgggctcgcg
ggccgcgagggagacctgctgcgcaaggtgctgccgtggagcctcggcctgctgctggtc
atgtgcctgatcgtggtcgggcagtccacggcggtcctcggctggatgctgccctga

DBGET integrated database retrieval system