KEGG   Streptomyces coelicolor: SCO3039Help
Entry
SCO3039           CDS       T00085                                 

Gene name
SCE34.20c
Definition
(RefSeq) nucleotide phosphorylase
  KO
K00966  
mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
sco  Streptomyces coelicolor
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
   00051 Fructose and mannose metabolism
    SCO3039 (SCE34.20c)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO3039 (SCE34.20c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     SCO3039 (SCE34.20c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3325773..3326855)
Genome map
AA seq 360 aa AA seqDB search
MTEAILLVGGKGTRLRPLTVNTPKPMVRAAGVPFLTHQLARAKAAGVEHIVLATSYLAEV
FEPYFGDGSTLGLHLEYVTEEEPLGTGGAIRNVASRLHSGPDEPVLIFNGDILTGLDIGA
LVRTHETTGADVSLHLTQVTDPRAYGLVPTDDTGRVLAFLEKPQTPEEIVTDQINAGAYV
FRRSVIDTIPAGRPVSVERETFPELLATGAHLQGMVDSTYWLDLGTPAAFVRGSADLVLG
RAPSPAVPGRCGDRLVLPTAQVAPDAKLTGGTVVGEGAFVAEGARVFGSTILPGAVIEPG
AVITDSLIGTRARVGTRSVLADTVIGDGAVIGADNELRSGARIWCDAHIPPASLRFSPDT
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgacagaagcgatcctcctggtcggcggcaagggcacgcggctgcggccgctcacggtg
aacacgcccaagcccatggtccgggccgccggagtgccgttcctcacgcaccagctggcg
cgggccaaggcggccggcgtcgaacacatcgtgctcgcgacgagctacctggccgaggtg
ttcgagccgtacttcggcgacggctcgacactcggcctgcacctcgagtacgtcacggag
gaggagccgctcggcaccggcggcgcgatccgcaacgtggcctcccggctgcactcgggc
cccgacgagccggtgctgatcttcaacggcgacatcctgacgggcctggacatcggcgcg
ctcgtccgcacccacgagacgacgggcgcggacgtctccctgcacctgacccaggtgacc
gacccgagggcgtacgggctggtccccacggacgacacgggccgagtgctcgccttcctg
gagaagccccagacccccgaggagatcgtcaccgaccagatcaacgcgggggcgtacgtc
ttccgccgctccgtcatcgacacgatcccggcgggccgcccggtctcggtcgaacgcgag
accttcccggaactcctcgccaccggcgcccacctccagggcatggtcgactccacgtac
tggctggacctgggcaccccggcggccttcgtccgcggctcggccgacctggtcctgggc
cgcgccccgtccccggccgtaccgggccgctgcggcgaccgcctcgtgctgcccacggca
caggtcgcgcccgacgccaagctgaccggcggcacggtggtcggcgagggcgccttcgtg
gcggagggggcgcgcgtcttcggcagcacgatcctgccgggcgccgtcatcgagccgggg
gccgtcatcaccgactccctcatcggcacccgcgcccgcgtcggcacccgctcggtcctc
gccgacacggtcatcggcgacggggcggtcatcggcgccgacaacgaactccgctccggc
gcccgcatctggtgcgacgcccacatcccccctgcatccctccgcttctcaccggacacg
tga

DBGET integrated database retrieval system