KEGG   Streptomyces coelicolor: SCO3052Help
Entry
SCO3052           CDS       T00085                                 

Gene name
SCBAC19G2.07
Definition
(RefSeq) UDP-glucose 6-dehydrogenase
  KO
K00012  
UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCO3052 (SCBAC19G2.07)
   00053 Ascorbate and aldarate metabolism
    SCO3052 (SCBAC19G2.07)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO3052 (SCBAC19G2.07)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     SCO3052 (SCBAC19G2.07)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
3344420..3345763
Genome map
AA seq 447 aa AA seqDB search
MALKITVIGTGYLGATHAAAMAELGFEVLGLDVVPEKIETLQRGEVPMYEPGLRELLGKH
VAGIEGSSGRLRFTTDFAEVAAFGDVHFLCVNTPQKHGEYACDMSYVDSALASLAPHLTG
PALVVGKSTVPVGSADRLAAYLAEHAPAGDGAELAWNPEFLREGFAVEDTLHPDRLVVGV
RSERAERLLREVYATPIEEGSPFVVTDFPTAELVKTAANSFLATKISFINAMAEVCEAAG
GDVAKLAEAIGYDDRIGKKFLRAGIGFGGGCLPKDIRAFMARAGELGADQALTFLREIDS
VNMRQRGRMVELTRQALGGGPFLGKRVAVLGATFKPDSDDVRDSPALNVAGQVHLQGAQV
TVYDPKGMENARRLFPTLGYADSALEAVRGADVVLHLTEWREFRELDPEVLGEAAAARVI
LDGRNALDPALWRKAGWTYRAMGRPTA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggccctgaagatcaccgtgatcggtaccggctatctcggcgccacccacgcggcggcc
atggccgagctcggtttcgaggtgctgggtctcgacgtggtgcccgagaagatcgagacg
ctccagcggggcgaggtcccgatgtacgagcccggtctgcgggagctgctgggcaagcac
gtcgccgggatcgagggctccagcgggcggctgcgcttcaccaccgacttcgccgaggtc
gcggccttcggcgacgtgcacttcctgtgtgtgaacaccccgcagaagcacggcgagtac
gcctgcgacatgtcgtacgtcgactccgcgctggcctccctggcgccgcacctgaccggc
cccgctctggtcgtcggcaagtcgaccgtgccggtgggctccgccgaccggctggccgcc
tacctggccgagcacgcgccggccggcgacggggccgagctggcctggaacccggagttc
ctgcgcgagggcttcgccgtcgaggacaccctgcaccccgaccgcctggtggtcggcgtg
cgcagcgagcgggccgagcggctgctgcgcgaggtgtacgcgacgccgatcgaggagggc
tcgccgttcgtcgtcacggacttcccgacggcggagctggtgaagaccgccgcgaactcc
ttcctcgccaccaagatctccttcatcaacgcgatggcggaggtctgcgaggccgcgggc
ggcgacgtcgccaagctggcggaggcgatcgggtacgacgaccggatcgggaagaagttc
ctgcgggccgggatcggcttcggcggcggctgtctgccgaaggacatccgggcgttcatg
gcgcgcgccggtgagctgggcgccgaccaggcgctgaccttcctgcgcgagatcgactcc
gtcaacatgcgccagcgcggccggatggtggagctgacccggcaggcgctgggcggcggc
cccttcctcggcaagcgcgtcgcggtgctcggcgccaccttcaagcccgactcggacgac
gtacgggactcccccgcgctgaacgtcgccgggcaggtgcacctccagggcgcccaggtg
acggtgtacgaccccaagggcatggagaacgcccggcggctcttcccgaccctcggctac
gccgactcggcgctggaggcggtgcggggcgctgacgtggtcctgcacctcacggagtgg
cgggagttccgcgagctggaccccgaggtgctgggcgaggcggctgcggcccgggtgatc
ctggacgggcgcaacgccctggatccggcgctgtggcggaaggccggctggacgtaccgg
gcgatgggccgcccgaccgcctga

DBGET integrated database retrieval system