KEGG   Streptomyces coelicolor: SCO3070Help
Entry
SCO3070           CDS       T00085                                 

Gene name
SCE25.11c
Definition
(RefSeq) imidazolonepropionase
  KO
K01468  
imidazolonepropionase [EC:3.5.2.7]
Organism
sco  Streptomyces coelicolor
Pathway
Histidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SCO3070 (SCE25.11c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.7  imidazolonepropionase
     SCO3070 (SCE25.11c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3362037..3363212)
Genome map
AA seq 391 aa AA seqDB search
MSSSTVITNIAALVTNDPSLGDHSPLGLVRDAAVVVEGDRVVWTGESSKAPATDNRVDAD
GRAVLPGFVDSHSHLLFAGDRTEEFNARMSGRPYSAGGIRTTVAATRAASDAELEAGLTR
YLAEALRQGTTTFETKSGYGLTTADESRALRVAARHTDEVTFLGAHIVAPELADDPAAYV
DLVTGEMLDACAPHARWIDVFCEKGAFDGDQARAILTAGKARGLHPRIHANQLSYGPGVR
LAVELDAASADHCTHLTDADVDALANSRTVATLLPGAEFSTRAQWPDARRLIDAGATVAL
STDCNPGSSFTSSVPFCIALAVRDMGMTPDEAVWSATAGGAAALRREDVGRLVPGAYADL
TLLDAPSHVHLAYRPGVPLVAGVWRRGVRKV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagcaccgtcatcaccaacatcgccgcactcgtcaccaacgacccctccctc
ggcgaccactccccgctcggtctggtccgggacgcggccgtcgtcgtcgagggcgaccgc
gtcgtgtggaccggtgaatcaagcaaagcacccgccactgacaaccgggtcgacgccgac
ggccgggcggtcctccccggcttcgtggactcccactcccacctcctcttcgcgggcgac
cgcaccgaggagttcaacgcccgcatgtccggccgcccctacagcgcgggcggcatccgc
accaccgtcgccgccacccgcgccgcgagcgacgcggaactggaggccggtctcacccgc
tacctcgccgaggccctgcgccagggcacgaccaccttcgagaccaagtccggctacggc
ctgaccaccgccgacgagtcccgggccctgcgggtcgccgcccgccacaccgacgaggtc
accttcctcggcgcccacatcgtcgcccccgaactcgccgacgaccccgccgcctacgtg
gacctggtcaccggggagatgctcgacgcctgcgcgccgcacgcccgctggatcgacgtg
ttctgcgagaagggcgccttcgacggcgaccaggcccgcgccatcctcaccgccggcaag
gccaggggcctgcacccccgcatccacgccaaccagctctcctacggccccggcgtccgg
ctcgccgtcgaactcgacgccgccagcgccgaccactgcacccacctcaccgacgccgac
gtggacgccctcgcgaacagccgtacggtcgcgaccctgctgcccggcgccgagttctcc
acccgcgcccagtggccggacgcccggcgcctgatcgacgccggtgccacggtggccctc
tccaccgactgcaaccccggctcctccttcacgtcctccgtccccttctgcatcgcgctc
gcggtacgggacatggggatgacgccggacgaggcggtctggtcggccaccgcgggcggc
gccgcggccctgcgccgcgaggacgtcggccgcctcgtcccgggcgcgtacgccgacctg
acgctgctcgacgccccgagccacgtccacctggcctaccggccgggggtgccgctggtc
gcgggtgtgtggcggcggggcgtgcgtaaggtgtga

DBGET integrated database retrieval system